website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

YEATS4 antibody - middle region (ARP30118_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30118_P050-FITC Conjugated

ARP30118_P050-HRP Conjugated

ARP30118_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
YEATS domain containing 4
Protein Name:
YEATS domain-containing protein 4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
YAF9, GAS41, NUBI-1, 4930573H17Rik, B230215M10Rik
Replacement Item:
This antibody may replace item sc-130762 from Santa Cruz Biotechnology.
Description of Target:
YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express YEATS4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express YEATS4.
The immunogen is a synthetic peptide directed towards the middle region of human YEATS4
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-YEATS4 (ARP30118_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-YEATS4 (ARP30118_P050) antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
Datasheets / Downloads:
Printable datasheet for anti-YEATS4 (ARP30118_P050) antibody
Sample Type Confirmation:

YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Zimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631

Product Protocols: YEATS4 antibody tested with Human Jurkat Cells (ARP30118_P050)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody (ARP30118_P050)

Click here to view the YEATS4 antibody Western Blot Protocol

Product Datasheet Link: YEATS4 antibody (ARP30118_P050)

WB Suggested Anti-YEATS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:

Description of Target: YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s YEATS4 antibody (ARP30118_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: YEATS4 antibody tested by IHC with human lung (ARP30118)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: YEATS4 antibody (ARP30118)

IHC Information:

Rabbit Anti-YEATS4 Antibody
Catalog Number: ARP30118
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: YEATS4 antibody tested by IHC with human heart (ARP30118)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: YEATS4 antibody (ARP30118)

IHC Information:

Rabbit Anti-YEATS4 Antibody
Catalog Number: ARP30118
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question