website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

YEATS4 antibody - middle region (ARP30118_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Gene Symbol:
YEATS4
Official Gene Full Name:
YEATS domain containing 4
NCBI Gene Id:
8089
Alias Symbols:
YAF9; GAS41; NUBI-1; 4930573H17Rik; B230215M10Rik
Sample Type Confirmation:

YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express YEATS4.
Protein Accession #:
NP_006521
Nucleotide Accession#:
NM_006530
Swissprot Id:
O95619
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
YEATS domain-containing protein 4
Protein Size (# AA):
227
Molecular Weight:
25kDa
Application:
IHC, WB
Partner Proteins:
FOXM1, BRCA1, CCNF, CDC20, CDK1, CDK1, CDK1, CDK1, CDK1, CDK1, CDKN1A, CKS2, ESPL1, FZR1, GADD45A, GADD45G, PTCH1, ZC3HC1, BRCA1, CCNB1IP1, CCNF, CDC25A, CDC25C, CDK1, CDKN1A, CDKN1B, FLNA, FZR1, GADD45B, GADD45G, HERC5, ITPR1, KAT5, MAP4, MEF2C, PBK, PCNA, PIN1, PKMYT1, PLK1, PTCH1, PTMA, RAGE, R
Immunogen:
The immunogen for anti-YEATS4 antibody: synthetic peptide directed towards the middle region of human YEATS4
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
YEATS4 antibody - middle region (ARP30118_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Species Reactivity:
Rat, Sheep, Dog, Horse, Human, Rabbit, Guinea pig, Bovine, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-YEATS4 antibody
- ARP30118_P050
Peptide Sequence:
Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Blocking Peptide:
For anti-YEATS4 antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
Key Reference:
Zimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-YEATS4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question