website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


YEATS4 antibody - middle region (ARP30118_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    YEATS domain containing 4
    Protein Name:
    YEATS domain-containing protein 4
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    YAF9, GAS41, NUBI-1, 4930573H17Rik, B230215M10Rik
    Description of Target:
    YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express YEATS4.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express YEATS4.
    The immunogen is a synthetic peptide directed towards the middle region of human YEATS4
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
    Complete computational species homology data:
    Anti-YEATS4 (ARP30118_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-YEATS4 (ARP30118_P050) antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
    Datasheets / Downloads:
    Printable datasheet for anti-YEATS4 (ARP30118_P050) antibody
    Sample Type Confirmation:

    YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

    Target Reference:
    Zimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631

    Product Protocols: YEATS4 antibody tested with Human Jurkat Cells (ARP30118_P050)

    Aviva Systems Biology is the original manufacturer of this YEATS4 antibody (ARP30118_P050)

    Click here to view the YEATS4 antibody Western Blot Protocol

    Product Datasheet Link: YEATS4 antibody (ARP30118_P050)

    WB Suggested Anti-YEATS4 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: Jurkat

    Western Blot image:

    Description of Target: YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s YEATS4 antibody (ARP30118_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Protocols: YEATS4 antibody tested by IHC with human lung (ARP30118)

    Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

    Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: YEATS4 antibody (ARP30118)

    IHC Information:

    Rabbit Anti-YEATS4 Antibody
    Catalog Number: ARP30118
    Paraffin Embedded Tissue: Human Lung
    Cellular Data: Alveolar cells
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Product Protocols: YEATS4 antibody tested by IHC with human heart (ARP30118)

    Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

    Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: YEATS4 antibody (ARP30118)

    IHC Information:

    Rabbit Anti-YEATS4 Antibody
    Catalog Number: ARP30118
    Paraffin Embedded Tissue: Human Heart
    Cellular Data: Myocardial cells
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Ask a Question