website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

YEATS4 antibody - middle region (ARP30118_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Gene Symbol:
Official Gene Full Name:
YEATS domain containing 4
NCBI Gene Id:
Alias Symbols:
YAF9; GAS41; NUBI-1; 4930573H17Rik; B230215M10Rik
Sample Type Confirmation:

YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express YEATS4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
YEATS domain-containing protein 4
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-YEATS4 antibody: synthetic peptide directed towards the middle region of human YEATS4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
YEATS4 antibody - middle region (ARP30118_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Species Reactivity:
Rat, Sheep, Dog, Horse, Human, Rabbit, Guinea pig, Bovine, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-YEATS4 antibody
- ARP30118_P050
Peptide Sequence:
Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Blocking Peptide:
For anti-YEATS4 antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
Target Reference:
Zimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for YEATS4 antibody (ARP30118)

Product page for YEATS4 antibody (ARP30118)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100667649 antibody; Loxodonta africana LOC100667649 antibody G3SLZ0 100%
Bovine YEATS4 antibody; Bos taurus YEATS4 antibody Q32LE1 100%
Chicken YEATS4 antibody; Gallus gallus YEATS4 antibody Q8UVS4 92%
Chicken YEATS4 antibody; Gallus gallus YEATS4 antibody E1BU44 92%
Common turkey YEATS4 antibody; Meleagris gallopavo YEATS4 antibody G1NDP7 92%
Dog YEATS4 antibody; Canis familiaris YEATS4 antibody E2QSI2 100%
Duckbill platypus YEATS4 antibody; Ornithorhynchus anatinus YEATS4 antibody F7CJ95 100%
Giant panda LOC100482765 antibody; Ailuropoda melanoleuca LOC100482765 antibody G1LZE9 100%
Gray short-tailed opossum LOC100011152 antibody; Monodelphis domestica LOC100011152 antibody F7F6E5 100%
Guinea pig LOC100728359 antibody; Cavia porcellus LOC100728359 antibody H0VIA7 100%
Horse YEATS4 antibody; Equus caballus YEATS4 antibody F7BYT2 100%
Human YEATS4 antibody; Homo sapiens YEATS4 antibody F8W0J4 100%
Human YETS4 antibody; Homo sapiens YETS4 antibody O95619 100%
Little brown bat YEATS4 antibody; Myotis lucifugus YEATS4 antibody G1PDI6 100%
Lowland gorilla YEATS4 antibody; Gorilla gorilla gorilla YEATS4 antibody G3S5K4 100%
Lowland gorilla YEATS4 antibody; Gorilla gorilla gorilla YEATS4 antibody G3RYG4 100%
Mouse YETS4 antibody; Mus musculus YETS4 antibody Q9CR11 100%
Northern pike YETS4 antibody; Esox lucius YETS4 antibody C1BX90 85%
Northern white-cheeked gibbon LOC100594422 antibody; Nomascus leucogenys LOC100594422 antibody G1QUL7 100%
Rabbit YEATS4 antibody; Oryctolagus cuniculus YEATS4 antibody G1T1I3 100%
Rat Yeats4 antibody; Rattus norvegicus Yeats4 antibody B2RYE9 100%
Sheep YEATS4 antibody; Ovis aries YEATS4 antibody C5ISA1 100%
Small-eared galago YEATS4 antibody; Otolemur garnettii YEATS4 antibody H0WY03 100%
Tasmanian devil YEATS4 antibody; Sarcophilus harrisii YEATS4 antibody G3VLE2 100%
White-tufted-ear marmoset LOC100394047 antibody; Callithrix jacchus LOC100394047 antibody F7HFQ0 100%
Zebra finch LOC100217948 antibody; Taeniopygia guttata LOC100217948 antibody H0Z946 92%
Zebra finch LOC100231727 antibody; Taeniopygia guttata LOC100231727 antibody H0ZVE5 92%
Zebrafish yeats4 antibody; Danio rerio yeats4 antibody Q6DGB4 78%

Product Protocols: YEATS4 antibody tested with Human Jurkat Cells (ARP30118_P050)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody (ARP30118_P050)

Click here to view the YEATS4 antibody Western Blot Protocol

Product Datasheet Link: YEATS4 antibody (ARP30118_P050)

WB Suggested Anti-YEATS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:

Description of Target: YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s YEATS4 antibody (ARP30118_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: YEATS4 antibody tested by IHC with human lung (ARP30118)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: YEATS4 antibody (ARP30118)

IHC Information:

Rabbit Anti-YEATS4 Antibody
Catalog Number: ARP30118
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: YEATS4 antibody tested by IHC with human heart (ARP30118)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: YEATS4 antibody (ARP30118)

IHC Information:

Rabbit Anti-YEATS4 Antibody
Catalog Number: ARP30118
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question