website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

YEATS4 antibody - middle region (ARP30118_P050)

  • Catalog#: ARP30118_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30118_P050-FITC Conjugated

    ARP30118_P050-HRP Conjugated

    ARP30118_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    YEATS4
    NCBI Gene Id:
    8089
    Official Gene Full Name:
    YEATS domain containing 4
    Protein Name:
    YEATS domain-containing protein 4
    Swissprot Id:
    O95619
    Protein Accession #:
    NP_006521
    Nucleotide Accession #:
    NM_006530
    Alias Symbols:
    YAF9, GAS41, NUBI-1, 4930573H17Rik, B230215M10Rik
    Replacement Item:
    This antibody may replace item sc-130762 from Santa Cruz Biotechnology.
    Description of Target:
    YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
    Protein Size (# AA):
    227
    Molecular Weight:
    25kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express YEATS4.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express YEATS4.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human YEATS4
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
    Complete computational species homology data:
    Anti-YEATS4 (ARP30118_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; HECW2; LYN; TFAP2B; BRD3; VIM; UBTF; FRMD4A; KDM1A; RNF8; MYCN; MYC; H2AFZ; DMAP1; KAT5; tat; MRGBP; RUVBL2; RUVBL1; TACC1; TACC2; PFDN1; MLLT10; SMARCB1; NUMA1; ING3; CEP162;
    Blocking Peptide:
    For anti-YEATS4 (ARP30118_P050) antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
    Datasheets / Downloads:
    Printable datasheet for anti-YEATS4 (ARP30118_P050) antibody
    Sample Type Confirmation:

    YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

    Target Reference:
    Zimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631

    Product Protocols: YEATS4 antibody tested with Human Jurkat Cells (ARP30118_P050)

    Aviva Systems Biology is the original manufacturer of this YEATS4 antibody (ARP30118_P050)

    Click here to view the YEATS4 antibody Western Blot Protocol

    Product Datasheet Link: YEATS4 antibody (ARP30118_P050)

    WB Suggested Anti-YEATS4 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: Jurkat

    Western Blot image:


    Description of Target: YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s YEATS4 antibody (ARP30118_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

    Product Protocols: YEATS4 antibody tested by IHC with human lung (ARP30118)

    Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

    Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: YEATS4 antibody (ARP30118)

    IHC Information:

    Rabbit Anti-YEATS4 Antibody
    Catalog Number: ARP30118
    Paraffin Embedded Tissue: Human Lung
    Cellular Data: Alveolar cells
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Product Protocols: YEATS4 antibody tested by IHC with human heart (ARP30118)

    Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

    Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: YEATS4 antibody (ARP30118)

    IHC Information:

    Rabbit Anti-YEATS4 Antibody
    Catalog Number: ARP30118
    Paraffin Embedded Tissue: Human Heart
    Cellular Data: Myocardial cells
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

     
    X
    Ask a Question