website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

YEATS4 antibody - middle region (ARP30118_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Gene Symbol:
YEATS4
Official Gene Full Name:
YEATS domain containing 4
NCBI Gene Id:
8089
Alias Symbols:
YAF9; GAS41; NUBI-1; 4930573H17Rik; B230215M10Rik
Sample Type Confirmation:

YEATS4 is supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express YEATS4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express YEATS4.
Swissprot Id:
O95619
Protein Accession #:
NP_006521
Nucleotide Accession #:
NM_006530
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
YEATS domain-containing protein 4
Protein Size (# AA):
227
Molecular Weight:
25kDa
Application:
IHC, WB
Protein Interactions:
UBC; HECW2; LYN; TFAP2B; BRD3; VIM; UBTF; FRMD4A; KDM1A; RNF8; MYCN; MYC; H2AFZ; DMAP1; KAT5; tat; MRGBP; RUVBL2; RUVBL1; TACC1; TACC2; PFDN1; MLLT10; SMARCB1; NUMA1; ING3; CEP162;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human YEATS4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-YEATS4 (ARP30118_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Species Reactivity:
Rat, Sheep, Dog, Horse, Human, Rabbit, Guinea pig, Bovine, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-YEATS4 (ARP30118_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Blocking Peptide:
For anti-YEATS4 (ARP30118_P050) antibody is Catalog # AAP30118 (Previous Catalog # AAPH00294)
Target Reference:
Zimmermann,K., et al., (2002) J. Biol. Chem. 277 (21), 18626-18631
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: YEATS4 antibody tested with Human Jurkat Cells (ARP30118_P050)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody (ARP30118_P050)

Click here to view the YEATS4 antibody Western Blot Protocol

Product Datasheet Link: YEATS4 antibody (ARP30118_P050)

WB Suggested Anti-YEATS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:


Description of Target: YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s YEATS4 antibody (ARP30118_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: YEATS4 antibody tested by IHC with human lung (ARP30118)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: YEATS4 antibody (ARP30118)

IHC Information:

Rabbit Anti-YEATS4 Antibody
Catalog Number: ARP30118
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: YEATS4 antibody tested by IHC with human heart (ARP30118)

Aviva Systems Biology is the original manufacturer of this YEATS4 antibody.

Click here to view the YEATS4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: YEATS4 antibody (ARP30118)

IHC Information:

Rabbit Anti-YEATS4 Antibody
Catalog Number: ARP30118
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question