- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
XBP1 Antibody - C-terminal region (ARP38553_P050)
Datasheets/Manuals | Printable datasheet for anti-XBP1 (ARP38553_P050) antibody |
---|
Tested Species Reactivity | Human, Dog |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human XBP1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 79%; Horse: 85%; Human: 100%; Mouse: 91%; Pig: 86%; Rabbit: 86%; Rat: 91% |
Peptide Sequence | Synthetic peptide located within the following region: LISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-XBP1 (ARP38553_P050) antibody is Catalog # AAP38553 (Previous Catalog # AAPP20744) |
Reference | Davies,M.P., (2008) Int. J. Cancer 123 (1), 85-88 |
Publications | Exclusion of the unfolded protein response in light-induced retinal degeneration in the canine T4R RHO model of autosomal dominant retinitis pigmentosa. PLoS One. 10, e0115723 (2015). 25695253 |
Description |
Gene Symbol | XBP1 |
---|---|
Gene Full Name | X-box binding protein 1 |
Alias Symbols | XBP2, TREB5, XBP-1, TREB-5 |
NCBI Gene Id | 7494 |
Protein Name | X-box-binding protein 1 |
Description of Target | XBP1 is a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. XBP1 is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator.This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5. |
Uniprot ID | P17861 |
Protein Accession # | NP_005071 |
Nucleotide Accession # | NM_005080 |
Protein Size (# AA) | 261 |
Molecular Weight | 29kDa |
Protein Interactions | DERL1; UBE2I; HM13; XBP1; CREBZF; ATF6; ATF6B; UBC; SUMO2; PSMA8; PSMA6; PSMA5; ZNF440; PCBD2; ZNF580; TRIP4; H1FX; FUBP3; NR0B2; SSX4; SRSF1; RBL2; HDGF; H1F0; GLI1; IRE1; FOS; ESR1; FOXA1; POLR2A; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
The tested species reactivity for this item is "Human, Dog". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig, Rabbit".
-
How long will it take to receive "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "XBP1 Antibody - C-terminal region (ARP38553_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
This target may also be called "XBP2, TREB5, XBP-1, TREB-5" in publications.
-
What is the shipping cost for "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "29kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "XBP1 Antibody - C-terminal region (ARP38553_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "XBP1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "XBP1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "XBP1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "XBP1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "XBP1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "XBP1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.