VDAC3 Antibody - N-terminal region (ARP35180_P050)

Catalog No: ARP35180_P050

WB Suggested Anti-VDAC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Host: Rabbit
Target Name: VDAC3
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlVDAC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Host: Rabbit
Target Name: VDAC3
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: VDAC3
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Rabbit Anti-VDAC3 antibody
Catalog Number: ARP35180_P050
Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-VDAC3 (ARP35180_P050) antibody is Catalog # AAP35180 (Previous Catalog # AAPP06415)
• Sample Type Confirmation:

  VDAC3 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Lefievre,L., (2007) Proteomics 7 (17), 3066-3084
• Publications:

  Majumder, S. & Fisk, H. A. VDAC3 and Mps1 negatively regulate ciliogenesis. Cell Cycle 12, 849-58 (2013). 23388454

  Majumder, S., Slabodnick, M., Pike, A., Marquardt, J. & Fisk, H. A. VDAC3 regulates centriole assembly by targeting Mps1 to centrosomes. Cell Cycle 11, 3666-78 (2012). 22935710

  Non-Overlapping Distributions and Functions of the VDAC Family in Ciliogenesis. Cells. 4, 331-53 (2015). 26264029

Target Info

• Gene Symbol: VDAC3
• Gene Full Name: Voltage-dependent anion channel 3
• Alias Symbols: VDAC-3, HD-VDAC3
• NCBI Gene Id: 7419
• Protein Name: Voltage-dependent anion-selective channel protein 3
• Description of Target: VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase.VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase (see HK1; MIM 142600) and glycerol kinase (GK; MIM 300474) (Rahmani et al., 1998).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1413 AF038962.1 2-1414
• Uniprot ID: Q9Y277
• Protein Accession #: NP_005653
• Nucleotide Accession #: NM_005662
• Protein Size (# AA): 283
• Molecular Weight: 31kDa
• Protein Interactions: UBC; RNF2; FBXO6; PARK2; env; ATF2; SCO2; VAPA; VAPB; LAMTOR3; SF1; VDAC2; VDAC1; UBA52; TKT; THY1; SCP2; PIN4; NDUFA7; ABCC1; EIF4A1; SERPINH1; ACAA1; Htt; TMEM256; MRPL53; SARNP; SRPRB; SUGP1; CDV3; RBM27; ATP6V1H; SBDS; YME1L1; SF3B4; PPIF; PQBP1; Tubb