- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
VCY Antibody - N-terminal region (ARP65849_P050)
Datasheets/Manuals | Printable datasheet for ARP65849_P050 |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Horse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human VCY |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Horse: 100%; Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: RKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAES |
Concentration | 0.5 mg/ml |
Blocking Peptide | Catalog # AAP65849 |
Gene Symbol | VCY |
---|---|
Alias Symbols | BPY1, VCY1, VCY1A |
NCBI Gene Id | 9084 |
Protein Name | Testis-specific basic protein Y 1 |
Description of Target | The protein encoded by this gene is a member of a family of human VCX/Y genes. This gene family has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. Members of the VCX/Y family share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. VCX/Y genes encode small and highly charged proteins of unknown function. This gene encodes a small, positively charged protein. The presence of a putative bipartite nuclear localization signal suggests that this gene encodes a nuclear protein. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. |
Uniprot ID | O14598 |
Protein Accession # | NP_004670 |
Nucleotide Accession # | NM_004679 |
Protein Size (# AA) | 125 |
Molecular Weight | 13kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "VCY Antibody - N-terminal region (ARP65849_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Horse".
-
How long will it take to receive "VCY Antibody - N-terminal region (ARP65849_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "VCY Antibody - N-terminal region (ARP65849_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "VCY Antibody - N-terminal region (ARP65849_P050)"?
This target may also be called "BPY1, VCY1, VCY1A" in publications.
-
What is the shipping cost for "VCY Antibody - N-terminal region (ARP65849_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "VCY Antibody - N-terminal region (ARP65849_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "VCY Antibody - N-terminal region (ARP65849_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "13kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "VCY Antibody - N-terminal region (ARP65849_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "VCY"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "VCY"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "VCY"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "VCY"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "VCY"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "VCY"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.