UTX Antibody - N-terminal region (ARP39482_P050)

Catalog No: ARP39482_P050

WB Suggested Anti-UTX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UTX
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KDM6A (ARP39482_P050) antibody is Catalog # AAP39482

Target Info

• Gene Symbol: KDM6A
• Gene Full Name: Lysine (K)-specific demethylase 6A
• Alias Symbols: UTX, KABUK2, bA386N14.2
• NCBI Gene Id: 7403
• Protein Name: Lysine-specific demethylase 6A
• Description of Target: UTX is a histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. It demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. UTX plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.
• Uniprot ID: O15550
• Protein Accession #: NP_066963
• Nucleotide Accession #: NM_021140
• Protein Size (# AA): 1401
• Molecular Weight: 154kDa
• Protein Interactions: KMT2D; WDR5; ASH2L; RBBP5; SMAD9; HIST2H3C; SRF; SMARCA4; GATA4; NKX2-5; TBX5; UBC; HIST1H3A; WDR82; PAXIP1; NCOA6; TLE1; PROSER1; KMT2C; N4BP2; PPP6R3; ZNF281; HIST3H3;