UPF3B Antibody - middle region (ARP41088_P050)

Catalog No: ARP41088_P050

WB Suggested Anti-UPF3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UPF3B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UPF3B (ARP41088_P050) antibody is Catalog # AAP41088 (Previous Catalog # AAPS02009)
• Reference: Chamieh,H., (2008) Nat. Struct. Mol. Biol. 15 (1), 85-93

Target Info

• Gene Symbol: UPF3B
• Gene Full Name: UPF3 regulator of nonsense transcripts homolog B (yeast)
• Alias Symbols: MRX62, MRX82, UPF3X, HUPF3B, MRXS14, RENT3B, UPF3BP1, UPF3BP2, UPF3BP3, Upf3p-X
• NCBI Gene Id: 65109
• Protein Name: Regulator of nonsense transcripts 3B
• Description of Target: UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9BZI7
• Protein Accession #: NP_542199
• Nucleotide Accession #: NM_080632
• Protein Size (# AA): 483
• Molecular Weight: 58kDa
• Protein Interactions: NCBP1; CIAO1; STAU1; UBC; UPF1; HECW2; RBM8A; UPF2; SMG1; EIF4A3; WIBG; WBP11; RNPS1; SART1; TOP2A; SNRPA1; NXF1; CAND1; COPS5; CUL5; USP21; EXOSC4; MCRS1; XRN1; TTC19; EIF6; UPF3B; HBB; UPF3A;