SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP59054_P050
Price: $0.00
SKU
ARP59054_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TXNIP (ARP59054_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TXNIP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSC
Concentration0.5 mg/ml
Blocking PeptideFor anti-TXNIP (ARP59054_P050) antibody is Catalog # AAP59054 (Previous Catalog # AAPP45046)
Gene SymbolTXNIP
Gene Full NameThioredoxin interacting protein
Alias SymbolsTHIF, VDUP1, ARRDC6, HHCPA78, EST01027
NCBI Gene Id10628
Protein NameThioredoxin-interacting protein
Description of TargetTXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.
Uniprot IDQ9H3M7
Protein Accession #NP_006463
Nucleotide Accession #NM_006472
Protein Size (# AA)391
Molecular Weight44kDa
Protein InteractionsUBC; DDIT4; ECD; TXN; TP53; SMURF2; UL49; ITCH; ELAVL1; FHL1; ZBTB32; ZBTB16; SCEL; HDAC1; TXNRD1; KPNA2;
  1. What is the species homology for "TXNIP Antibody - middle region (ARP59054_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "TXNIP Antibody - middle region (ARP59054_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TXNIP Antibody - middle region (ARP59054_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TXNIP Antibody - middle region (ARP59054_P050)"?

    This target may also be called "THIF, VDUP1, ARRDC6, HHCPA78, EST01027" in publications.

  5. What is the shipping cost for "TXNIP Antibody - middle region (ARP59054_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TXNIP Antibody - middle region (ARP59054_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TXNIP Antibody - middle region (ARP59054_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TXNIP Antibody - middle region (ARP59054_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TXNIP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TXNIP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TXNIP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TXNIP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TXNIP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TXNIP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TXNIP Antibody - middle region (ARP59054_P050)
Your Rating
We found other products you might like!