TSFM Antibody - middle region (ARP31455_P050)

Catalog No: ARP31455_P050

WB Suggested Anti-TSFM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate.TSFM is strongly supported by BioGPS gene expression data to be expressed in HeLa

Host: Rabbit
Target Name: TSFM
Sample Type: Human MCF7
Antibody Dilution: 1.0ug/mlTSFM is strongly supported by BioGPS gene expression data to be expressed in MCF7

Host: Rabbit
Target Name: TSFM
Sample Type: Human 721_B
Antibody Dilution: 1.0ug/mlTSFM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Host: Rabbit
Target Name: TSFM
Sample Type: Human 293T
Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that TSFM is expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSFM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TSFM (ARP31455_P050) antibody is Catalog # AAP31455 (Previous Catalog # AAPY00204)
• Sample Type Confirmation:

  TSFM is strongly supported by BioGPS gene expression data to be expressed in 721_B, HeLa, MCF7

  There is BioGPS gene expression data showing that TSFM is expressed in HEK293T

• Reference: Smeitink,J.A., (2006) Am. J. Hum. Genet. 79 (5), 869-877

Target Info

• Gene Symbol: TSFM
• Gene Full Name: Ts translation elongation factor, mitochondrial
• Alias Symbols: EFTS, EFTSMT
• NCBI Gene Id: 10102
• Protein Name: Elongation factor Ts, mitochondrial
• Description of Target: The TSFM protein is a mitochondrial translation elongation factor. Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes.Synthesis of the 13 mitochondrial-encoded proteins occurs on a dedicated mitochondrial translation apparatus similar to that found in prokaryotes and requires, in addition to the tRNAs and rRNAs encoded in mtDNA, the concerted action of several translation factors and a large number of mitochondrial ribosomal proteins, all of which are encoded by nuclear genes. The TSFM gene encodes a mitochondrial translation elongation factor (Smeitink et al., 2006 [PubMed 17033963]).[supplied by OMIM].
• Uniprot ID: P43897
• Protein Accession #: NP_005717
• Nucleotide Accession #: NM_005726
• Protein Size (# AA): 346
• Molecular Weight: 38kDa
• Protein Interactions: UBC; SUMO2; LIG4; C1QBP; MRRF; ACOT13; CDV3; MTRNR2L1;