TRIM6 Antibody - N-terminal region (ARP34654_P050)

Catalog No: ARP34654_P050

WB Suggested Anti-TRIM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Horse: 83%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 79%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: CWLCERSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQEAEKLTAFI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRIM6 (ARP34654_P050) antibody is Catalog # AAP34654 (Previous Catalog # AAPP05844)
• Reference: Li,X., (2006) J. Virol. 80 (13), 6198-6206

Target Info

• Gene Symbol: TRIM6
• Gene Full Name: Tripartite motif containing 6
• Alias Symbols: RNF89
• NCBI Gene Id: 117854
• Protein Name: Tripartite motif-containing protein 6
• Description of Target: TRIM6 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the nucleus, but its specific function has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the nucleus, but its specific function has not been identified. This gene is mapped to chromosome 11p15, where it resides within a TRIM gene cluster. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. A read-through transcript transcribed from this gene and TRIM34 has been observed.
• Uniprot ID: A8K2A7
• Protein Accession #: NP_001003818
• Nucleotide Accession #: NM_001003818
• Protein Size (# AA): 516
• Molecular Weight: 59kDa
• Protein Interactions: IKBKE; UBC; TRIM5; TRIM6; MYC; TRIM28; TRIM23;