SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33376_T100
Price: $0.00
SKU
ARP33376_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-STAT4 (ARP33376_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STAT4
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-STAT4 (ARP33376_T100) antibody is Catalog # AAP33376 (Previous Catalog # AAPP04422)
Sample Type Confirmation

STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat

Enhanced Validation
WBY
SPR
YCHAROS
ReferenceTorpey,N., et al., (2004) J. Biol. Chem. 279 (25), 26789-26796
Gene SymbolSTAT4
Gene Full NameSignal transducer and activator of transcription 4
Alias SymbolsSLEB11
NCBI Gene Id6775
Protein NameSignal transducer and activator of transcription 4
Description of TargetSTAT4 is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells.
Uniprot IDQ14765
Protein Accession #NP_003142
Nucleotide Accession #NM_003151
Protein Size (# AA)748
Molecular Weight86 kDa
Protein InteractionsUBC; ADRB2; TRIM28; FHL1; ZNF467; PIAS2; NMI; IL12RB2; IL12RB1; MAP2K6; STAT4; MAPK14; CREBBP; JUN; STAT3; IFNGR1;
  1. What is the species homology for "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STAT4 Antibody - N-terminal region (ARP33376_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    This target may also be called "SLEB11" in publications.

  5. What is the shipping cost for "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "86 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAT4 Antibody - N-terminal region (ARP33376_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "STAT4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAT4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAT4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAT4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAT4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAT4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAT4 Antibody - N-terminal region (ARP33376_T100)
Your Rating
We found other products you might like!