SENP6 Antibody - C-terminal region (ARP50600_P050)

Catalog No: ARP50600_P050

WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateSENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Sample Type: 1.Rat Testis cells (200ug) 
Primary Dilution: 1:1000
Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit
Secondary Dilution: 1:1000
Image Submitted by: Andreia Carvalho
IBMC-OBF, Portugal See Customer Feedback tab for detailed information.

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Cow, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SENP6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Horse: 79%; Human: 100%; Pig: 91%
• Peptide Sequence: Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SENP6 (ARP50600_P050) antibody is Catalog # AAP50600 (Previous Catalog # AAPY02450)
• Sample Type Confirmation:

  SENP6 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: SENP6
• Gene Full Name: SUMO1/sentrin specific peptidase 6
• Alias Symbols: SSP1, SUSP1
• NCBI Gene Id: 26054
• Protein Name: Sentrin-specific protease 6
• Description of Target: SENP6 is a UBL-specific protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. It does not seem to be involved in the processing of full-length SUMO proteins to their mature forms. SENP6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. It may act preferentially on substrates containing 3 or more SUMO2 or SUMO3 moieties.Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM].
• Uniprot ID: Q9GZR1
• Protein Accession #: NP_001093879
• Nucleotide Accession #: NM_001100409
• Protein Size (# AA): 1105
• Molecular Weight: 125kDa
• Protein Interactions: UBC; SP1; LMNA; COPS5; SUMO2; KAT5; SUMO1; PLA2G2A; RUVBL2; ARNT;