SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41274_P050
Price: $0.00
SKU
ARP41274_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RHOU (ARP41274_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human RHOU
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV
Concentration0.5 mg/ml
Blocking PeptideFor anti-RHOU (ARP41274_P050) antibody is Catalog # AAP41274 (Previous Catalog # AAPP22629)
ReferenceChuang,Y.Y., J. Cell. Sci. 120 (PT 11), 1927-1934 (2007)
Gene SymbolRHOU
Gene Full NameRas homolog family member U
Alias SymbolsARHU, G28K, WRCH1, hG28K, CDC42L1
NCBI Gene Id58480
Protein NameRho-related GTP-binding protein RhoU
Description of TargetRHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.
Uniprot IDQ7L0Q8
Protein Accession #NP_067028
Nucleotide Accession #NM_021205
Protein Size (# AA)258
Molecular Weight28kDa
Protein InteractionsPAK1; NCK1; PLCG1; GRB2;
  1. What is the species homology for "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RHOU Antibody - C-terminal region (ARP41274_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    This target may also be called "ARHU, G28K, WRCH1, hG28K, CDC42L1" in publications.

  5. What is the shipping cost for "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RHOU Antibody - C-terminal region (ARP41274_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RHOU"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RHOU"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RHOU"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RHOU"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RHOU"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RHOU"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RHOU Antibody - C-terminal region (ARP41274_P050)
Your Rating