RASGRP4 Antibody - N-terminal region (ARP62124_P050)

Catalog No: ARP62124_P050

WB Suggested Anti-RASGRP4 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 92%
• Peptide Sequence: Synthetic peptide located within the following region: FWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RASGRP4 (ARP62124_P050) antibody is Catalog # AAP62124 (Previous Catalog # AAPP48443)

Target Info

• Gene Symbol: RASGRP4
• Gene Full Name: RAS guanyl releasing protein 4
• Alias Symbols: -
• NCBI Gene Id: 115727
• Protein Name: RAS guanyl-releasing protein 4
• Description of Target: The protein encoded by this gene is a member of the Ras guanyl nucleotide-releasing protein (RasGRP) family of Ras guanine nucleotide exchange factors. It contains a Ras exchange motif, a diacylglycerol-binding domain, and two calcium-binding EF hands. This protein was shown to activate H-Ras in a cation-dependent manner in vitro. Expression of this protein in myeloid cell lines was found to be correlated with elevated level of activated RAS protein, and the RAS activation can be greatly enhanced by phorbol ester treatment, which suggested a role of this protein in diacylglycerol regulated cell signaling pathways. Studies of a mast cell leukemia cell line expressing substantial amounts of abnormal transcripts of this gene indicated that this gene may play an important role in the final stages of mast cell development. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: C0LTP7
• Protein Accession #: NP_001139679
• Nucleotide Accession #: NM_001146207
• Protein Size (# AA): 576
• Molecular Weight: 63kDa
• Protein Interactions: HRAS; RAP1A;