Ppp1ca Antibody - C-terminal region (ARP62624_P050)

Catalog No: ARP62624_P050

Host: Rabbit
Target Name: Ppp1ca
Sample Type: Mouse Spleen lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Ppp1ca (ARP62624_P050) antibody is Catalog # AAP62624

Target Info

• Gene Symbol: Ppp1ca
• Gene Full Name: protein phosphatase 1, catalytic subunit, alpha isozyme
• Alias Symbols: Pp, dis, Ppp1c, dism2
• NCBI Gene Id: 19045
• Protein Name: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
• Description of Target: Ppp1ca is a protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development.
• Uniprot ID: P62137
• Protein Accession #: NP_114074
• Nucleotide Accession #: NM_031868
• Protein Size (# AA): 330
• Molecular Weight: 37kDa
• Protein Interactions: Eed; Plcb1; Wbp11; SH3KBP1; Ccnb1; Atr; Eif2a; Cdc34; Ppp2r4; Lbr; Tsc1; Skp1a; Pcna; Nek2; Mapt; Max; Id2; Hspa1b; Ptk2; Cdkn2a; Ccne1; Ccnd3; Ccna1; Bcl2; Atm; Apaf1; Pou5f1; Apc; SNCA; TGFBR1; Stau1; Ppp1r9b; Ppp1r9a;