PNMA3 Antibody - middle region (ARP54946_P050)

Catalog No: ARP54946_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-PNMA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMA3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PNMA3 (ARP54946_P050) antibody is Catalog # AAP54946 (Previous Catalog # AAPP37204)
• Reference: Wills,N.M., (2006) J. Biol. Chem. 281 (11), 7082-7088

Target Info

• Gene Symbol: PNMA3
• Gene Full Name: Paraneoplastic Ma antigen 3
• Alias Symbols: MA3, MA5
• NCBI Gene Id: 29944
• Protein Name: Paraneoplastic antigen Ma3
• Description of Target: The specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.
• Uniprot ID: Q9UL41
• Protein Accession #: NP_037496
• Nucleotide Accession #: NM_013364
• Protein Size (# AA): 463
• Molecular Weight: 52kDa
• Protein Interactions: PARD6G;