PHF21A Antibody - middle region (ARP34557_P050)

Catalog No: ARP34557_P050

WB Suggested Anti-PHF21A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHF21A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PHF21A (ARP34557_P050) antibody is Catalog # AAP34557 (Previous Catalog # AAPP05739)
• Reference: Hailesellasse (er) BMC Genomics 8, 85 (2007)

Target Info

• Gene Symbol: PHF21A
• Gene Full Name: PHD finger protein 21A
• Alias Symbols: BHC80, NEDMS, BM-006, IDDBCS
• NCBI Gene Id: 51317
• Protein Name: PHD finger protein 21A
• Description of Target: PHF21A (BHC80) is a component of a BRAF35/histone deacetylase complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS).BHC80 is a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).[supplied by OMIM].
• Uniprot ID: Q96BD5-2
• Protein Accession #: NP_057705
• Nucleotide Accession #: NM_016621
• Protein Size (# AA): 634
• Molecular Weight: 70kDa
• Protein Interactions: KRT40; BANP; NUP62; ZYX; TRAF1; FHL3; HDAC2; HDAC1; HIST3H3; HMG20B; ELAVL1; SUMO2; HIST2H3C; ESCO2; KDM1A; TAF10; RCOR1; LPXN; GTF2I;