- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for anti-NUP62 (ARP70972_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human NUP62 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 85%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Rat: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NUP62 (ARP70972_P050) antibody is Catalog # AAP70972 |
| Sample Type Confirmation | NUP62 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Gene Symbol | NUP62 |
|---|---|
| Alias Symbols | p62, IBSN, SNDI |
| NCBI Gene Id | 23636 |
| Protein Name | Nuclear pore glycoprotein p62 |
| Description of Target | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP62 is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. |
| Uniprot ID | P37198 |
| Protein Accession # | NP_714941 |
| Nucleotide Accession # | NM_153719 |
| Protein Size (# AA) | 522 |
| Molecular Weight | 57kDa |
| Protein Interactions | CEP57L1; CCDC150; SSC5D; KANSL1; CCDC153; TXLNA; AGR3; C1orf216; IKBIP; HAUS1; KLHL32; IFT20; MYO15B; CENPU; CCDC121; CCDC146; THAP1; CRCT1; CCHCR1; KRT20; NUP54; PHF21A; CCDC53; BLOC1S6; ISCU; XPO6; OIP5; NXF1; SNAPC5; NUTF2; ABI2; NUPL1; ADAM15; UBC; SM |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NUP62 Antibody - middle region (ARP70972_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig".
-
How long will it take to receive "NUP62 Antibody - middle region (ARP70972_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "NUP62 Antibody - middle region (ARP70972_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NUP62 Antibody - middle region (ARP70972_P050)"?
This target may also be called "p62, IBSN, SNDI" in publications.
-
What is the shipping cost for "NUP62 Antibody - middle region (ARP70972_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NUP62 Antibody - middle region (ARP70972_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NUP62 Antibody - middle region (ARP70972_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "57kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NUP62 Antibody - middle region (ARP70972_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NUP62"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NUP62"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NUP62"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NUP62"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NUP62"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NUP62"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
