NUCB2 Antibody - middle region (ARP36567_T100)

Catalog No: ARP36567_T100

Lanes:
Lane 1: 50ug HEK293 lysate
Lane 2: 50ug MDCK lysate
Lane 3: 50ug NMuMG lysate
Lane 4: 50ug MDAMB231 lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Goat anti-rabbit-Alexa Fluor 680
Secondary Antibody Dilution:
1:10,000
Gene Name:
NUCB2
Submitted by:
Dr. Mikel Garcia-Marcos, Boston University School of Medicine

Host: Rabbit
Target Name: NUCB2
Sample Tissue: Human COLO205
Antibody Dilution: 1.0ug/ml

Host: Mouse
Target Name: NUCB2
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Human Intestine

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUCB2
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 91%
• Peptide Sequence: Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-NUCB2 (ARP36567_T100) antibody is Catalog # AAP36567 (Previous Catalog # AAPP07718)
• Reference: Line,A., et al., (2002) J. Cancer 86 (11), 1824-1830
• Publications:

  Nucleobindin 2 (NUCB2) in human endometrial carcinoma: a potent prognostic factor associated with cell proliferation and migration. Endocr. J. 63, 287-99 (2016). 26842712

  Suzuki, S. et al. Nucleobindin 2 in human breast carcinoma as a potent prognostic factor. Cancer Sci. 103, 136-43 (2012). 21988594

Target Info

• Gene Symbol: NUCB2
• Gene Full Name: Nucleobindin 2
• Alias Symbols: NEFA, HEL-S-109
• NCBI Gene Id: 4925
• Protein Name: Nucleobindin-2
• Description of Target: Nucleobindin-2 is a calcium-binding EF-hand protein.
• Uniprot ID: P80303
• Protein Accession #: NP_005004
• Nucleotide Accession #: NM_005013
• Protein Size (# AA): 420
• Molecular Weight: 46kDa
• Protein Interactions: UBC; NEDD8; TUBB6; CAMK1D; NAE1; HSPA1L; CLU; GNAS; GNAI3; GADD45A; XPO1; SMARCD1; CUL2; NR1I2; NDN; STAR;