KCNC4 Antibody - middle region (ARP35161_P050)

Catalog No: ARP35161_P050

WB Suggested Anti-KCNC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Skeletal muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded skeletal muscle tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNC4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNC4 (ARP35161_P050) antibody is Catalog # AAP35161 (Previous Catalog # AAPP06392)
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Target Info

• Gene Symbol: KCNC4
• Gene Full Name: Potassium voltage-gated channel, Shaw-related subfamily, member 4
• Alias Symbols: KV3.4, C1orf30, KSHIIIC, HKSHIIIC
• NCBI Gene Id: 3749
• Protein Name: Potassium voltage-gated channel subfamily C member 4
• Description of Target: KCNC4 is part of the Shaker gene family of Drosophila. It encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. KCNC4 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene.The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q03721-2
• Protein Accession #: NP_720198
• Nucleotide Accession #: NM_153763
• Protein Size (# AA): 582
• Molecular Weight: 64kDa