HOXB4 Antibody - N-terminal region (ARP39581_P050)

Catalog No: ARP39581_P050

WB Suggested Anti-HOXB4 Antibody
Titration: 1 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HOXB4 (ARP39581_P050) antibody is Catalog # AAPP21601
• Reference: Haddad,R., (2008) Stem Cells 26 (2), 312-322

Target Info

• Gene Symbol: HOXB4
• Gene Full Name: Homeobox B4
• Alias Symbols: HOX2, HOX2F, HOX-2.6
• NCBI Gene Id: 3214
• Protein Name: Homeobox protein Hox-B4
• Description of Target: HOXB4 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. This gene is included in a cluster of homeobox B genes located on chromosome 17. HOXB4 functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P17483
• Protein Accession #: NP_076920
• Nucleotide Accession #: NM_024015
• Protein Size (# AA): 251
• Molecular Weight: 27kDa
• Protein Interactions: DDB1; RBX1; CUL4A; CREBBP; EP300; MEIS1;