HNRPM Antibody - N-terminal region (ARP40620_P050)

Catalog No: ARP40620_P050

WB Suggested Anti-HNRPM Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateHNRNPM is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HNRNPM (ARP40620_P050) antibody is Catalog # AAP40620 (Previous Catalog # AAPP22380)
• Sample Type Confirmation:

  HNRNPM is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Publications:

  Huelga, S. C. et al. Integrative genome-wide analysis reveals cooperative regulation of alternative splicing by hnRNP proteins. Cell Rep. 1, 167-78 (2012). 22574288

Target Info

• Gene Symbol: HNRNPM
• Gene Full Name: Heterogeneous nuclear ribonucleoprotein M
• Alias Symbols: CEAR, HNRPM, HTGR1, NAGR1, HNRPM4, HNRNPM4, hnRNP M
• NCBI Gene Id: 4670
• Protein Name: Heterogeneous nuclear ribonucleoprotein M
• Description of Target: HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPM has three repeats of quasi-RRM domains that bind to RNAs. HNRPM also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Multiple alternatively spliced transcript variants are known for this gene but only two transcripts has been isolated.
• Uniprot ID: P52272
• Protein Accession #: NP_112480
• Nucleotide Accession #: NM_031203
• Protein Size (# AA): 691
• Molecular Weight: 73kDa
• Protein Interactions: UBC; TP53; AKAP9; TEKT4; GMCL1P1; LMO2; HNRNPF; SUMO2; SUMO3; CEP250; MDM2; HAUS1; CDC37; IVNS1ABP; STAU1; SUMO1; RPA3; RPA2; RPA1; EED; rev; RTCB; RPL26L1; RFC4; PSMB8; NMT1; MRE11A; FLII; IGF2BP3; EIF2B2; EIF2B3; RPL27; RPL19; DHX9; DDX1; ABCF1; PARK2;