SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100832_T100
Price: $0.00
SKU
P100832_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GABPA (P100832_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GABPA
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG
Concentration1.0 mg/ml
Blocking PeptideFor anti-GABPA (P100832_T100) antibody is Catalog # AAP31187 (Previous Catalog # AAPP01930)
Sample Type Confirmation

GABPA is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceXue, H.H., et al., (2004) Nat.Immunol.5(10),1036-1044
Description
Gene SymbolGABPA
Gene Full NameGA binding protein transcription factor, alpha subunit 60kDa
Alias SymbolsNFT2, NRF2, NRF2A, E4TF1A, E4TF1-60, RCH04A07
NCBI Gene Id2551
Protein NameGA-binding protein alpha chain
Description of TargetGA Binding Protein . chain (GABP-. subunit, GABPA, nuclear respiratory factor-2 subunit . transcription factor E4TF1-60) is one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype.
Uniprot IDQ06546
Protein Accession #NP_002031
Nucleotide Accession #NM_002040
Protein Size (# AA)454
Molecular Weight51kDa
Protein InteractionsUBC; NCOA7; KCTD12; TSEN34; DIABLO; CUTC; RAB3GAP2; LIMCH1; RAB3GAP1; GNE; KPNA1; YY1; GABPB1; PINX1; APP; KEAP1; SUMO2; HDAC1; EP300; SP3; CREBBP; HCFC1; SP1; ATF1; MED1;
  1. What is the species homology for "GABPA Antibody - C-terminal region (P100832_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Zebrafish".

  2. How long will it take to receive "GABPA Antibody - C-terminal region (P100832_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GABPA Antibody - C-terminal region (P100832_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GABPA Antibody - C-terminal region (P100832_T100)"?

    This target may also be called "NFT2, NRF2, NRF2A, E4TF1A, E4TF1-60, RCH04A07" in publications.

  5. What is the shipping cost for "GABPA Antibody - C-terminal region (P100832_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GABPA Antibody - C-terminal region (P100832_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GABPA Antibody - C-terminal region (P100832_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GABPA Antibody - C-terminal region (P100832_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GABPA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GABPA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GABPA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GABPA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GABPA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GABPA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GABPA Antibody - C-terminal region (P100832_T100)
Your Rating
We found other products you might like!