FZD9 Antibody - N-terminal region (ARP41253_T100)

Catalog No: ARP41253_T100

WB Suggested Anti-FZD9 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Rabbit Anti-FZD9 Antibody
Catalog Number: ARP41253
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FZD9
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-FZD9 (ARP41253_T100) antibody is Catalog # AAP41253 (Previous Catalog # AAPP22608)
• Reference: Winn,R.A., (2005) J. Biol. Chem. 280 (20), 19625-19634
• Publications:

  Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). 20234818

Target Info

• Gene Symbol: FZD9
• Gene Full Name: Frizzled family receptor 9
• Alias Symbols: FZD3, CD349
• NCBI Gene Id: 8326
• Protein Name: Frizzled-9
• Description of Target: FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
• Uniprot ID: O00144
• Protein Accession #: NP_003499
• Nucleotide Accession #: NM_003508
• Protein Size (# AA): 591
• Molecular Weight: 65kDa
• Protein Interactions: KRTAP10-3; SIAH1; MDFI; WNT7A; WNT1; WNT2;