FDXR Antibody - N-terminal region (ARP54706_P050)

Catalog No: ARP54706_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: FDXR
Antibody Dilution: 1.0ug/ml
Sample Type: Human Small Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: DHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FDXR (ARP54706_P050) antibody is Catalog # AAP54706

Target Info

• Gene Symbol: FDXR
• Gene Full Name: Ferredoxin reductase
• Alias Symbols: ADR, ADXR, ANOA
• NCBI Gene Id: 2232
• Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial
• Description of Target: This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.
• Uniprot ID: P22570
• Protein Accession #: NP_077728
• Nucleotide Accession #: NM_024417
• Protein Size (# AA): 491
• Molecular Weight: 54kDa
• Protein Interactions: UBC; NEDD8; FHIT; POU2F1; FDX1;