SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62142_P050
Price: $0.00
SKU
ARP62142_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EXOSC9 (ARP62142_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: ERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQV
Concentration0.5 mg/ml
Blocking PeptideFor anti-EXOSC9 (ARP62142_P050) antibody is Catalog # AAP62142 (Previous Catalog # AAPP48460)
Gene SymbolEXOSC9
Gene Full NameExosome component 9
Alias Symbolsp5, p6, PCH1D, RRP45, PMSCL1, Rrp45p, PM/Scl-75
NCBI Gene Id5393
Protein NameExosome complex component RRP45
Description of TargetEXOSC9 is a non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC9 binds to ARE-containing RNAs.
Uniprot IDQ06265
Protein Accession #NP_005024
Nucleotide Accession #NM_005033
Protein Size (# AA)355
Molecular Weight39kDa
Protein InteractionsUBC; EXOSC4; MPG; AICDA; CSNK2A1; EXOSC5; EXOSC10; EXOSC3; EXOSC2; DIS3; DIS3L; CHMP4B; CAND1; COPS5; CUL3; SUMO2; UBE2I; EXOSC1; SKIV2L2; EXOSC6; DDX39A; MPP6; EXOSC7; EXOSC8; EXOSC9; DDX39B;
  1. What is the species homology for "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EXOSC9 Antibody - N-terminal region (ARP62142_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    This target may also be called "p5, p6, PCH1D, RRP45, PMSCL1, Rrp45p, PM/Scl-75" in publications.

  5. What is the shipping cost for "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EXOSC9 Antibody - N-terminal region (ARP62142_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EXOSC9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EXOSC9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EXOSC9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EXOSC9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EXOSC9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EXOSC9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EXOSC9 Antibody - N-terminal region (ARP62142_P050)
Your Rating
We found other products you might like!