Ehf Antibody - middle region (ARP36843_P050)

Catalog No: ARP36843_P050

WB Suggested Anti-Ehf Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Brain

Immunohistochemistry with Breast tissue at an antibody concentration of 5ug/ml using anti-Ehf antibody (ARP36843_P050)

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Ehf (ARP36843_P050) antibody is Catalog # AAP36843 (Previous Catalog # AAPP09916)

Target Info

• Gene Symbol: Ehf
• Gene Full Name: Ets homologous factor
• Alias Symbols: AU019492, 9030625L19Rik
• NCBI Gene Id: 13661
• Protein Name: ETS homologous factor
• Description of Target: Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades.Ehf binds to DNA sequences containing the consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter.
• Uniprot ID: O70273
• Protein Accession #: NP_031940
• Nucleotide Accession #: NM_007914
• Protein Size (# AA): 300
• Molecular Weight: 35kDa
• Protein Interactions: Nfkbiz;