DCN Antibody - N-terminal region (ARP48199_P050)

Catalog No: ARP48199_P050

WB Suggested Anti-DCN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Skin

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 2.5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DCN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Goat: 92%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 86%; Sheep: 92%
• Peptide Sequence: Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DCN (ARP48199_P050) antibody is Catalog # AAP48199 (Previous Catalog # AAPS22710)
• Reference: Nakatani,T., Mol. Cell. Biochem. 308 (1-2), 201-207 (2008)

Target Info

• Gene Symbol: DCN
• Gene Full Name: Decorin
• Alias Symbols: CSCD, PG40, PGII, PGS2, DSPG2, SLRR1B
• NCBI Gene Id: 1634
• Protein Name: Decorin
• Description of Target: DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. This protein and biglycan are thought to be the result of a gene duplication. DCN is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.
• Uniprot ID: P07585
• Protein Accession #: NP_001911
• Nucleotide Accession #: NM_001920
• Protein Size (# AA): 359
• Molecular Weight: 36kDa
• Protein Interactions: BRCA1; MET; WISP1; COL4A6; COL4A5; FLNA; TNF; TGFB1; THBS1; MMP3; MMP7; SFTPD; PLA2G2A; AHSG; FN1; FBN1; EGFR; ELN; DPT; C1QA; MMP2; COL14A1; COL5A1; COL1A2; COL1A1; COL4A4; COL4A1; COL4A3; TGFB2; COL6A1;