COX15 Antibody - N-terminal region (ARP46442_T100)

Catalog No: ARP46442_T100

Lanes:
Lane1: 20ug human fibroblast mitochondria
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-Rabbit HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
COX15
Submitted by:
Oleh Khalimonchuk, University of Nebraska-Lincoln

Rabbit Anti-COX15 Antibody
Catalog Number: ARP46442
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X - See more at: http://www.avivasysbio.com/cox15-antibody-n-terminal-region-arp46442-t100.html#sthash.41yjSrAu.dpuf

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COX15
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-COX15 (ARP46442_T100) antibody is Catalog # AAP46442 (Previous Catalog # AAPS18308)
• Sample Type Confirmation:

  COX15 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Oquendo,C.E., (2004) J. Med. Genet. 41 (7), 540-544
• Publications:

  Analysis of Oligomerization Properties of Heme a Synthase Provides Insights into Its Function in Eukaryotes. J. Biol. Chem. 291, 10411-25 (2016). 26940873

Target Info

• Gene Symbol: COX15
• Gene Full Name: COX15 homolog, cytochrome c oxidase assembly protein (yeast)
• Alias Symbols: MC4DN6, CEMCOX2
• NCBI Gene Id: 1355
• Protein Name: Cytochrome c oxidase assembly protein COX15 homolog
• Description of Target: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.
• Uniprot ID: Q7KZN9-2
• Protein Accession #: NP_004367
• Nucleotide Accession #: NM_004376
• Protein Size (# AA): 388
• Molecular Weight: 46 kDa
• Protein Interactions: UBC; CLN3; MRPS14; NDUFA12; TOMM7; MRPL15; LAMTOR3; SURF1; NDUFS8; NDUFS6; NDUFS4; NDUFA9; CYC1;