CACNA1I Antibody - middle region (ARP35319_P050)

Catalog No: ARP35319_P050

WB Suggested Anti-CACNA1I Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNA1I
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CACNA1I (ARP35319_P050) antibody is Catalog # AAP35319 (Previous Catalog # AAPP06555)
• Subunit: alpha-1I
• Reference: Hildebrand,M.E., (2007) J. Biol. Chem. 282 (29), 21043-21055

Target Info

• Gene Symbol: CACNA1I
• Gene Full Name: Calcium channel, voltage-dependent, T type, alpha 1I subunit
• Alias Symbols: Cav3.3, ca(v)3.3
• NCBI Gene Id: 8911
• Protein Name: Voltage-dependent T-type calcium channel subunit alpha-1I
• Description of Target: Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.[supplied by OMIM].
• Uniprot ID: Q9P0X4
• Protein Accession #: NP_001003406
• Nucleotide Accession #: NM_001003406
• Protein Size (# AA): 2188
• Molecular Weight: 245kDa
• Protein Interactions: ALB;