SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37246_P050
Price: $0.00
SKU
ARP37246_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Atf7ip (ARP37246_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse, Rat, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Mouse Atf7ip
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceMouse: 100%; Pig: 92%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: MSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVESK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Atf7ip (ARP37246_P050) antibody is Catalog # AAP37246
Gene SymbolAtf7ip
Gene Full Nameactivating transcription factor 7 interacting protein
Alias SymbolsA, AM, Mcaf, Mcaf1, 2610204M12Rik, 5830415B17Rik
NCBI Gene Id54343
Protein NameActivating transcription factor 7-interacting protein 1
Description of TargetRecruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Atf7ip can both act as an activator or a repressor depending on the context. It mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Atf7ip is required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3). Atf7ip may have ATPase activity.
Uniprot IDQ7TT18
Protein Accession #NP_062299
Nucleotide Accession #NM_019426
Protein Size (# AA)1306
Molecular Weight138kDa
Protein InteractionsAtf7; Gtf2f1; Gtf2e2; Aagab; Ccnh; Gtf2h1; Ercc3; Cdk7; C1qbp; POLR2H; POLR2G; POLR2D; POLR2C;
  1. What is the species homology for "Atf7ip Antibody - middle region (ARP37246_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse, Rat, Pig".

  2. How long will it take to receive "Atf7ip Antibody - middle region (ARP37246_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Atf7ip Antibody - middle region (ARP37246_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Atf7ip Antibody - middle region (ARP37246_P050)"?

    This target may also be called "A, AM, Mcaf, Mcaf1, 2610204M12Rik, 5830415B17Rik" in publications.

  5. What is the shipping cost for "Atf7ip Antibody - middle region (ARP37246_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Atf7ip Antibody - middle region (ARP37246_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Atf7ip Antibody - middle region (ARP37246_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "138kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Atf7ip Antibody - middle region (ARP37246_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATF7IP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATF7IP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATF7IP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATF7IP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATF7IP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATF7IP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Atf7ip Antibody - middle region (ARP37246_P050)
Your Rating