SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48184_P050
Price: $0.00
SKU
ARP48184_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ARF1 (ARP48184_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, IP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast 100%
Peptide SequenceSynthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARF1 (ARP48184_P050) antibody is Catalog # AAP48184 (Previous Catalog # AAPP28693)
Other Applications Image 1 DataIP Suggested Anti-ARF1 Antibody
Positive Control: NT2 CELL/BRAIN TISSUE
ReferenceHattori,Y., (2007) Biochem. Biophys. Res. Commun. 364 (4), 737-742
Other Applications Image 2 DataIP Suggested Anti-ARF1 antibody
Titration: 2 ug/ml
Positive Control: Rat brain homogenate
Gene SymbolARF1
Gene Full NameADP-ribosylation factor 1
Alias SymbolsPVNH8
NCBI Gene Id375
Protein NameADP-ribosylation factor 3
Description of TargetADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Uniprot IDP61204
Protein Accession #NP_001649
Nucleotide Accession #NM_001658
Protein Size (# AA)181
Molecular Weight21kDa
Protein InteractionsGGA1; GGA3; GGA2; HUWE1; UBC; FBXO6; MMS19; TMEM106A; VCAM1; ITGA4; ATF2; ARF3; UBD; GRK5; CDK2; HERC1; Proser1; AI837181; Kif1c; Bach1; nef; COPB1; GEA1; WBP11; TMED2; PICK1; NOA1; TMED10; EEF1G; PLEKHA8; COPG1; ARFIP1; ARFIP2; ARHGAP21; ARFGAP1; AP3D1;
  1. What is the species homology for "ARF1 Antibody - middle region (ARP48184_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish, Yeast".

  2. How long will it take to receive "ARF1 Antibody - middle region (ARP48184_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARF1 Antibody - middle region (ARP48184_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARF1 Antibody - middle region (ARP48184_P050)"?

    This target may also be called "PVNH8" in publications.

  5. What is the shipping cost for "ARF1 Antibody - middle region (ARP48184_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARF1 Antibody - middle region (ARP48184_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARF1 Antibody - middle region (ARP48184_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARF1 Antibody - middle region (ARP48184_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ARF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARF1 Antibody - middle region (ARP48184_P050)
Your Rating
We found other products you might like!