TAF15 antibody - N-terminal region (ARP30111_T100)

Catalog#: ARP30111_T100

• Size: 100ug

Human HepG2

• Description of Target: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF15 encodes a subunit of TFIID present in a subset of TFIID complexes. Translocations involving chromosome 17 and chromosome 9, where the gene for the nuclear receptor CSMF is located, result in a gene fusion product that is an RNA binding protein associated with a subset of extraskeletal myxoid chondrosarcomas.
• Gene Symbol: TAF15
• Official Gene Full Name: TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
• Alias Symbols: Npl3; RBP56; TAF2N; TAFII68; hTAFII68
• Protein Accession#: NP_631961
• Nucleotide Accession#: NM_139215
• Swissprot Id: Q92804
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 592
• Molecular Weight: 62kDa
• Application: WB
• Partner Proteins: POLR2C, POLR2E, POLR2G, SAFB, SF1, TAF1, TAF12, TAF13, TAF5, TAF7, YWHAG, ZNF384, POLR2C, POLR2E, POLR2G, PRMT1, SAFB, SF1, TAF11, TAF13, TAF5, TAF7, TBP
• Immunogen: The immunogen for anti-TAF15 antibody: synthetic peptide directed towards the N terminal of human TAF15
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Bovine: 92%; Dog: 92%; Guinea pig: 92%; Horse: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Chicken: 78%
• Peptide Sequence: Synthetic peptide located within the following region: GGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSD
• Blocking Peptide: For anti-TAF15 antibody is Catalog # AAP30111 (Previous Catalog # AAPH00287)
• Key Reference: Lee,H.J., et al., (2004) FEBS Lett. 564 (1-2), 188-198
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-TAF15 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: Western blot analysis Protocol with TAF15 Antibody (Catalog Number: ARP30111_T100)

Product Protocols:
Western blot analysis Protocol with Gene Name: TAF15 Antibody (Catalog Number: ARP30111_T100)

Catalog Number: ARP30111_T100

Citation:
1. Schatz N, Brändlein S, Rückl K, Hensel F, Vollmers HP. Diagnostic and therapeutic potential of a human antibody cloned from a cancer patient that bindsto a tumor-specific variant of transcription factor TAF15. Cancer Res. 2010 Jan 1,70(1):398-408. PubMed PMID: 20048082.

Product Name: TAF15 antibody - N-terminal region (ARP30111_T100)

Gene Name: TAF15

Species: PAT-BA4-producing hybridoma cells and pancreatic adenocarcinoma cell line BxPC-3

Experiment Name: Western blot analysis

Experiment Background:
1. In this article, Nicole et al. showed that the natural IgG antibody PAT-BA4 binds to TAF15, a member of the TET family. PAT-BA4 is a germ-line-coded IgG antibody and therefore belongs to the innate immune system. It binds tumor specifically to the detected 78-kDa TAF15 variant.
2. The protein expression of TAF15 on malignant and nonmalignant cells was determined by Western blot analysis. Cell lysates, made of an identical amount (1.2 × 106) of BxPC-3 tumor cells or lymphocytes, were used. On the blots, the 78-kDa band was detected with anti-TAF15 antibody.

Experimental Steps:
1. Western blot analysis with PAT-BA4 and anti-TAF15 antibody of purified BxPC-3 cell membrane extract showed the same binding pattern. Both antibodies bind to the 78- kDa TAF15 protein.
2. To figure out if the antibodies also have the same epitope, a Western blot inhibition assay was performed.
3. Two different assays of each antibody (PAT-BA4 or anti-TAF15) were carried out. One assay was preincubated with the opponent antibody to check binding interactions, and the other one without the opponent antibody.

Product Protocols: TAF15 antibody tested with Human Hepg2 Cells (ARP30111_T100)

Aviva Systems Biology is the original manufacturer of this TAF15 antibody (ARP30111_T100)

Click here to view the TAF15 antibody Western Blot Protocol

Product Datasheet Link: TAF15 antibody (ARP30111_T100)

WB Suggested Anti-TAF15 Antibody Titration: 3.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF15 encodes a subunit of TFIID present in a subset of TFIID complexes. Translocations involving chromosome 17 and chromosome 9, where the gene for the nuclear receptor CSMF is located, result in a gene fusion product that is an RNA binding protein associated with a subset of extraskeletal myxoid chondrosarcomas.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TAF15 antibody (ARP30111_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com