- Description of Target:
- L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
- Gene Symbol:
- L3MBTL2
- Official Gene Full Name:
- L(3)mbt-like 2 (Drosophila)
- Alias Symbols:
- H-l(3)mbt-l; L3MBT
- Tissue Tool:
- Find tissues and cell lines supported to express L3MBTL2.

- Protein Accession# :
- NP_113676
- Nucleotide Accession#:
- NM_031488
- Swissprot Id:
- Q969R5
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 705
- Molecular Weight:
- 79kDa
- Application:
- WB, IHC
- Partner Proteins:
- MEAF6, PHF10, STAM2, CBX3, MEAF6, PHF10, RB1, STAM2
- Immunogen:
- The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the C terminal of human L3MBTL2
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- L3MBTL2 antibody - C-terminal region (ARP30080_T100)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Guinea pig: 100%; Rabbit: 100%; Pig: 92%; Rat: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-L3MBTL2 antibody
- ARP30080_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
- Blocking Peptide:
- For anti-L3MBTL2 antibody is Catalog # AAP30080 (Previous Catalog # AAPH00256)
- Key Reference:
- Collins,J.E., Genome Biol. 5 (10), R84 (2004)
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-L3MBTL2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: L3MBTL2 antibody tested with Human Transfected 293T Cells (ARP30080_T100)
Aviva Systems Biology is the original manufacturer of this L3MBTL2 antibody (ARP30080_T100)
Click here to view the L3MBTL2 antibody Western Blot Protocol
Product Datasheet Link: L3MBTL2 antibody (ARP30080_T100)
WB Suggested Anti-L3MBTL2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s L3MBTL2 antibody (ARP30080_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: L3MBTL2 antibody tested by IHC with human kidney (ARP30080)
Aviva Systems Biology is the original manufacturer of this L3MBTL2 antibody.
Click here to view the L3MBTL2 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: L3MBTL2 antibody (ARP30080)
IHC Information:
Rabbit Anti-L3MBTL2 Antibody
Catalog Number: ARP30080
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.


