- Description of Target:
- Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.
- Gene Symbol:
- KIN
- Official Gene Full Name:
- KIN, antigenic determinant of recA protein homolog (mouse)
- Alias Symbols:
- BTCD; KIN17
- Tissue Tool:
- Find tissues and cell lines supported to express KIN.
- Protein Accession# :
- NP_036443
- Nucleotide Accession#:
- NM_012311
- Swissprot Id:
- O60870
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 393
- Molecular Weight:
- 45kDa
- Application:
- WB, IHC
- Immunogen:
- The immunogen for anti-KIN antibody: synthetic peptide directed towards the middle region of human KIN
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- KIN antibody - middle region (ARP31690_P050)
- Predicted Homology Based on Immunogen Sequence:
- Horse: 100%; Human: 100%; Bovine: 84%; Dog: 84%; Guinea pig: 84%; Rabbit: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-KIN antibody
- ARP31690_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY
- Blocking Peptide:
- For anti-KIN antibody is Catalog # AAP31690 (Previous Catalog # AAPP02477)
- Key Reference:
- Despras,E., et al., (2003) Radiat.Res.159(6),748-758
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-KIN antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: KIN antibody tested with Human Hepg2 Cells (ARP31690_P050)
Aviva Systems Biology is the original manufacturer of this KIN antibody (ARP31690_P050)
Click here to view the KIN antibody Western Blot Protocol
Product Datasheet Link: KIN antibody (ARP31690_P050)
WB Suggested Anti-KIN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2
Western Blot image: 
Description of Target: Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s KIN antibody (ARP31690_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: KIN antibody tested by IHC with human spermatophore (ARP31690)
Aviva Systems Biology is the original manufacturer of this KIN antibody.
Click here to view the KIN antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: KIN antibody (ARP31690)
IHC Information:
Rabbit Anti-KIN Antibody
Catalog Number: ARP31690
Paraffin Embedded Tissue: Human Spermatophore
Cellular Data: Epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
Product Protocols: KIN antibody tested by IHC with human kidney (ARP31690)
Aviva Systems Biology is the original manufacturer of this KIN antibody.
Click here to view the KIN antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: KIN antibody (ARP31690)
IHC Information:
Rabbit Anti-KIN Antibody
Catalog Number: ARP31690
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
