- Description of Target:
- Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ8 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ8, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Gene Symbol:
- KCNJ8
- Official Gene Full Name:
- Potassium inwardly-rectifying channel, subfamily J, member 8
- Alias Symbols:
- KIR6.1; uKATP-1
- Tissue Tool:
- Find tissues and cell lines supported to express KCNJ8.
- Protein Accession# :
- NP_004973
- Nucleotide Accession#:
- NM_004982
- Swissprot Id:
- Q15842
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 424
- Molecular Weight:
- 48kDa
- Application:
- WB
- Partner Proteins:
- ADRB2, DRD2, KCNJ3, KCNJ6, KCNJ9, DRD4, KCNJ6
- Immunogen:
- The immunogen for anti-KCNJ8 antibody: synthetic peptide directed towards the middle region of human KCNJ8
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- KCNJ8 antibody - middle region (ARP35169_P050)
- Predicted Homology Based on Immunogen Sequence:
- African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-KCNJ8 antibody
- ARP35169_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK
- Blocking Peptide:
- For anti-KCNJ8 antibody is Catalog # AAP35169 (Previous Catalog # AAPP06404)
- Key Reference:
- Ji,W., (2008) Nat. Genet. 40 (5), 592-599
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-KCNJ8 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: KCNJ8 antibody tested with Human Hela Cells (ARP35169_P050)
Aviva Systems Biology is the original manufacturer of this KCNJ8 antibody (ARP35169_P050)
Click here to view the KCNJ8 antibody Western Blot Protocol
Product Datasheet Link: KCNJ8 antibody (ARP35169_P050)
WB Suggested Anti-KCNJ8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela
Western Blot image: 
Description of Target: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ8 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ8, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s KCNJ8 antibody (ARP35169_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
