ANKRD11 antibody - N-terminal region (ARP33542_T100)

Catalog#: ARP33542_T100

• Size: 100ug

Human Placenta

Human kidney

• Description of Target: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
• Gene Symbol: ANKRD11
• Official Gene Full Name: Ankyrin repeat domain 11
• Alias Symbols: T13; LZ16; ANCO1; ANCO-1
• Protein Accession#: NP_037407
• Nucleotide Accession#: NM_013275
• Swissprot Id: Q9UHR3
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 2663
• Molecular Weight: 298kDa
• Application: WB, IHC
• Partner Proteins: CRISP3, CRISP3
• Immunogen: The immunogen for anti-ANKRD11 antibody: synthetic peptide directed towards the N terminal of human ANKRD11
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 93%; African clawed frog: 85%; Chicken: 85%
• Peptide Sequence: Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
• Blocking Peptide: For anti-ANKRD11 antibody is Catalog # AAP33542 (Previous Catalog # AAPP04593)
• Key Reference: Zhang,A., et al., (2004) J. Biol. Chem. 279 (32), 33799-33805
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-ANKRD11 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: ANKRD11 antibody tested with Human Placenta Tissue (ARP33542_T100)

Aviva Systems Biology is the original manufacturer of this ANKRD11 antibody (ARP33542_T100)

Click here to view the ANKRD11 antibody Western Blot Protocol

Product Datasheet Link: ANKRD11 antibody (ARP33542_T100)

WB Suggested Anti-ANKRD11 Antibody Titration: 1.25ug/ml
Positive Control: Placenta

Western Blot image:


Description of Target: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ANKRD11 antibody (ARP33542_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: ANKRD11 antibody tested by IHC with human kidney (ARP33542)

Aviva Systems Biology is the original manufacturer of this ANKRD11 antibody.

Click here to view the ANKRD11 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ANKRD11 antibody (ARP33542)

IHC Information:

Rabbit Anti-ANKRD11 Antibody
Catalog Number: ARP33542
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: