APP Antibody - middle region (ARP33075_P050)

Catalog No: ARP33075_P050

WB Suggested Anti-APP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human heart

Sample Type:
Mouse hippo campus
Primary Antibody Dilution:
1:100
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:300
Color/Signal Descriptions:
App: Red Nucleus: Blue
Gene Name:
APP
Submitted by:
Teresa Gunn

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-APP (ARP33075_P050) antibody is Catalog # AAP33075 (Previous Catalog # AAPP04108)
• Reference: Locascio,J.J., (2008) Arch. Neurol. 65 (6), 776-785

Target Info

• Gene Symbol: APP
• Gene Full Name: Amyloid beta (A4) precursor protein
• Alias Symbols: AAA, AD1, PN2, ABPP, APPI, CVAP, ABETA, PN-II, preA4, CTFgamma, alpha-sAPP
• NCBI Gene Id: 351
• Protein Name: Amyloid beta A4 protein
• Description of Target: APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
• Uniprot ID: P05067
• Protein Accession #: NP_000475
• Nucleotide Accession #: NM_000484
• Protein Size (# AA): 770
• Molecular Weight: 85kDa