website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FZR1 antibody - N-terminal region (ARP51279_P050)

  • Catalog#: ARP51279_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock
    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Fizzy/cell division cycle 20 related 1 (Drosophila)
    Protein Name:
    Fizzy-related protein homolog
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242
    Replacement Item:
    This antibody may replace item sc-166714 from Santa Cruz Biotechnology.
    Description of Target:
    FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express FZR1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express FZR1.
    The immunogen is a synthetic peptide directed towards the N terminal region of human FZR1
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
    Complete computational species homology data:
    Anti-FZR1 (ARP51279_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-FZR1 (ARP51279_P050) antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
    Datasheets / Downloads:
    Printable datasheet for anti-FZR1 (ARP51279_P050) antibody
    Sample Type Confirmation:

    FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

    Product Protocols: FZR1 antibody tested with Human 721_B_Lymphoblast (ARP51279_P050)

    Aviva Systems Biology is the original manufacturer of this FZR1 antibody (ARP51279_P050)

    Click here to view the FZR1 antibody Western Blot Protocol

    Product Datasheet Link: FZR1 antibody (ARP51279_P050)

    WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml
    Positive Control: 721_B

    Western Blot image:

    Description of Target: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s FZR1 antibody (ARP51279_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question