website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CDC25C antibody - N-terminal region (AVARP03034_P050)

  • Catalog#: AVARP03034_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    CDC25C
    NCBI Gene Id:
    995
    Official Gene Full Name:
    Cell division cycle 25 homolog C (S. pombe)
    Protein Name:
    M-phase inducer phosphatase 3
    Swissprot Id:
    P30307
    Protein Accession #:
    NP_073720
    Nucleotide Accession #:
    NM_022809
    Alias Symbols:
    CDC25, PPP1R60
    Description of Target:
    CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
    Protein Size (# AA):
    400
    Molecular Weight:
    45kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express CDC25C.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express CDC25C.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human CDC25C
    Species Reactivity:
    Human, Mouse, Rabbit
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%; Mouse: 91%; Rabbit: 83%
    Complete computational species homology data:
    Anti-CDC25C (AVARP03034_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    CDC37; UBC; HSP90AA1; HSPA4; YWHAB; YWHAQ; YWHAZ; YWHAH; YWHAG; YWHAE; PKN1; SFN; MAPK9; PLK1; CHEK1; CHEK2; CDS1; MARK3; BRSK2; CDK2; PCNA; Cdk1; USP17L2; MAPK3; MAPK1; BRSK1; LZTS1; PLK3; NEDD4; PIN1; MAPK14; TP53; HRAS; LCK; CCNB1; CCNA2; SRC; SP1;
    Blocking Peptide:
    For anti-CDC25C (AVARP03034_P050) antibody is Catalog # AAP30150 (Previous Catalog # AAPP00307)
    Datasheets / Downloads:
    Printable datasheet for anti-CDC25C (AVARP03034_P050) antibody
    Sample Type Confirmation:

    There is BioGPS gene expression data showing that CDC25C is expressed in Jurkat

    Target Reference:
    Bonnet,J., (2008) Biochem. Biophys. Res. Commun. 370 (3), 483-488

    Product Protocols: CDC25C antibody tested with Human Jurkat Cells (AVARP03034_P050)

    Aviva Systems Biology is the original manufacturer of this CDC25C antibody (AVARP03034_P050)

    Click here to view the CDC25C antibody Western Blot Protocol

    Product Datasheet Link: CDC25C antibody (AVARP03034_P050)

    WB Suggested Anti-CDC25C Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: Jurkat

    Western Blot image:


    Description of Target: CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s CDC25C antibody (AVARP03034_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question