website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ANAPC10 antibody - N-terminal region (ARP43169_P050)

  • Catalog#: ARP43169_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP43169_P050-FITC Conjugated

    ARP43169_P050-HRP Conjugated

    ARP43169_P050-Biotin Conjugated

    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Anaphase promoting complex subunit 10
    Protein Name:
    Anaphase-promoting complex subunit 10
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    APC10, DKFZP564L0562, DOC1
    Description of Target:
    ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express ANAPC10.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express ANAPC10.
    The immunogen is a synthetic peptide directed towards the N terminal region of human ANAPC10
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
    Complete computational species homology data:
    Anti-ANAPC10 (ARP43169_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    ANAPC4; DCPS; UBC; ANAPC15; MDC1; TP53BP1; LIG4; ANAPC1; ANAPC7; ANAPC2; CDC16; CDC23; CDC27; Gm9174; Cdc20; Bub1b; PPP2R1A; APC2; ANAPC11; SMAD3; SMAD2; LRP1; LRP8; LRP2;
    Blocking Peptide:
    For anti-ANAPC10 (ARP43169_P050) antibody is Catalog # AAP43169 (Previous Catalog # AAPP25138)
    Datasheets / Downloads:
    Printable datasheet for anti-ANAPC10 (ARP43169_P050) antibody
    Target Reference:
    Nourry,C., (er) BMC Cell Biol. 5, 20 (2004)

    Product Protocols: ANAPC10 antibody tested with Human Fetal Spleen Tissue (ARP43169_P050)

    Aviva Systems Biology is the original manufacturer of this ANAPC10 antibody (ARP43169_P050)

    Click here to view the ANAPC10 antibody Western Blot Protocol

    Product Datasheet Link: ANAPC10 antibody (ARP43169_P050)

    WB Suggested Anti-ANAPC10 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Fetal Spleen

    Western Blot image:

    Description of Target: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s ANAPC10 antibody (ARP43169_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question