website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FZR1 antibody - N-terminal region (ARP51279_P050)

Description of Target:
FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Gene Symbol:
FZR1
Official Gene Full Name:
Fizzy/cell division cycle 20 related 1 (Drosophila)
NCBI Gene Id:
51343
Alias Symbols:
CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1; KIAA1242
Sample Type Confirmation:

FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Tissue Tool:
Find tissues and cell lines supported to express FZR1.
Protein Accession #:
NP_057347
Nucleotide Accession#:
NM_016263
Swissprot Id:
Q9UM11
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Fizzy-related protein homolog
Protein Size (# AA):
493
Molecular Weight:
55kDa
Application:
WB
Partner Proteins:
CCNB1, CDC27, NEDD9, ANAPC2, C7orf25, CCNB1, CDC14A, CDC27, CDK2, DNAJA1, FBXO5, SKIL, SKP2, SKP2, ANAPC1, ANAPC2, ANAPC4, ANAPC5, ANAPC7, CDC14A, CDC20, CDC27, CDT1, FBXO5, MAD2L2, SKIL, TPX2
Immunogen:
The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FZR1 antibody - N-terminal region (ARP51279_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Rat, Mouse, Dog, Pig, Horse, Guinea pig, Human, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-FZR1 antibody
- ARP51279_P050
Peptide Sequence:
Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Blocking Peptide:
For anti-FZR1 antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FZR1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question