website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

FZR1 antibody - N-terminal region (ARP51279_P050)

Description of Target:
FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Gene Symbol:
Official Gene Full Name:
Fizzy/cell division cycle 20 related 1 (Drosophila)
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Tissue Tool:
Find tissues and cell lines supported to express FZR1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Fizzy-related protein homolog
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
FZR1 antibody - N-terminal region (ARP51279_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Rat, Mouse, Dog, Pig, Horse, Guinea pig, Human, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-FZR1 antibody
- ARP51279_P050
Peptide Sequence:
Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Blocking Peptide:
For anti-FZR1 antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for FZR1 antibody (ARP51279)

Product page for FZR1 antibody (ARP51279)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog fzr1 antibody; Xenopus laevis fzr1 antibody Q7ZXE0 100%
African clawed frog fzr1 antibody; Xenopus laevis fzr1 antibody O42585 100%
African elephant FZR1 antibody; Loxodonta africana FZR1 antibody G3U1U6 100%
American bullfrog FZR antibody; Rana catesbeiana FZR antibody C1C4P7 100%
Atlantic salmon FZR antibody; Salmo salar FZR antibody C0HB41 100%
Bovine FZR1 antibody; Bos taurus FZR1 antibody Q32L05 100%
Chicken CDH1-A antibody; Gallus gallus CDH1-A antibody Q8UWJ5 100%
Chicken CDH1-A antibody; Gallus gallus CDH1-A antibody Q8UWJ7 100%
Chicken FZR1 antibody; Gallus gallus FZR1 antibody Q8UWJ6 100%
Chinese hamster Fzr1 antibody; Cricetulus griseus Fzr1 antibody G3HSJ7 100%
Common turkey FZR1 antibody; Meleagris gallopavo FZR1 antibody G3UT11 100%
Common turkey FZR1 antibody; Meleagris gallopavo FZR1 antibody G3UPN8 100%
Common turkey FZR1 antibody; Meleagris gallopavo FZR1 antibody G1MRR2 100%
Dog FZR1 antibody; Canis familiaris FZR1 antibody E2R4Z3 100%
Gray short-tailed opossum LOC100010404 antibody; Monodelphis domestica LOC100010404 antibody F6PS44 100%
Gray short-tailed opossum LOC100027495 antibody; Monodelphis domestica LOC100027495 antibody F6PJD6 78%
Gray short-tailed opossum LOC100029292 antibody; Monodelphis domestica LOC100029292 antibody F6ZDC9 92%
Guinea pig Fzr1 antibody; Cavia porcellus Fzr1 antibody H0W8B9 100%
Horse FZR1 antibody; Equus caballus FZR1 antibody F6WPH9 100%
Human FZR antibody; Homo sapiens FZR antibody Q9UM11 100%
Human FZR antibody; Homo sapiens FZR antibody Q9UM11-3 100%
Human FZR antibody; Homo sapiens FZR antibody Q9UM11-2 100%
Little brown bat FZR1 antibody; Myotis lucifugus FZR1 antibody G1P0C1 100%
Lowland gorilla FZR1 antibody; Gorilla gorilla gorilla FZR1 antibody G3QIF6 100%
Mouse FZR antibody; Mus musculus FZR antibody Q9R1K5 100%
Mouse Fzr1 antibody; Mus musculus Fzr1 antibody Q3U3D4 100%
Mouse Fzr1 antibody; Mus musculus Fzr1 antibody Q3U2B8 100%
Mouse Fzr1 antibody; Mus musculus Fzr1 antibody Q3TQ38 100%
Mouse Fzr1 antibody; Mus musculus Fzr1 antibody F8WJ80 100%
Mouse Fzr1 antibody; Mus musculus Fzr1 antibody D3YTV2 100%
Northern white-cheeked gibbon FZR1 antibody; Nomascus leucogenys FZR1 antibody G1QQM0 100%
Pig FZR1 antibody; Sus scrofa FZR1 antibody Q5H7B9 100%
Pig FZR1 antibody; Sus scrofa FZR1 antibody F1S8E3 100%
Rat Fzr1 antibody; Rattus norvegicus Fzr1 antibody D3Z9N8 100%
Rat Fzr1 antibody; Rattus norvegicus Fzr1 antibody B1WCA1 100%
Rhesus macaque FZR1 antibody; Macaca mulatta FZR1 antibody G7NLU2 100%
Rhesus macaque FZR1 antibody; Macaca mulatta FZR1 antibody F7GTB6 100%
Rhesus macaque FZR1 antibody; Macaca mulatta FZR1 antibody F6TG42 100%
Small-eared galago FZR1 antibody; Otolemur garnettii FZR1 antibody H0XAM8 100%
Three-spined stickleback FZR1 (1 of 2) antibody; Gasterosteus aculeatus FZR1 (1 of 2) antibody G3PR65 100%
Three-spined stickleback FZR1 (2 of 2) antibody; Gasterosteus aculeatus FZR1 (2 of 2) antibody G3P9D9 85%
Three-spined stickleback FZR1 (2 of 2) antibody; Gasterosteus aculeatus FZR1 (2 of 2) antibody G3P9D2 85%
Three-spined stickleback FZR1 (2 of 2) antibody; Gasterosteus aculeatus FZR1 (2 of 2) antibody G3P9B3 85%
Western clawed frog fzr1 antibody; Xenopus tropicalis fzr1 antibody F6Z3Z6 100%
Western clawed frog fzr1 antibody; Xenopus tropicalis fzr1 antibody F6S1M1 100%
Western clawed frog fzr1 antibody; Xenopus tropicalis fzr1 antibody B0BM37 100%
White-tufted-ear marmoset FZR1 antibody; Callithrix jacchus FZR1 antibody F7I7P5 100%
White-tufted-ear marmoset FZR1 antibody; Callithrix jacchus FZR1 antibody F7GUN8 100%
White-tufted-ear marmoset FZR1 antibody; Callithrix jacchus FZR1 antibody F7GUM2 100%
Zebra finch FZR1 antibody; Taeniopygia guttata FZR1 antibody H0YPI3 100%
Zebrafish fzr1 antibody; Danio rerio fzr1 antibody Q7ZUP9 100%
Zebrafish fzr1 antibody; Danio rerio fzr1 antibody B0S4Z8 100%
Zebrafish fzr1 antibody; Danio rerio fzr1 antibody B0S4Z7 100%

Product Protocols: FZR1 antibody tested with Human 721_B_Lymphoblast (ARP51279_P050)

Aviva Systems Biology is the original manufacturer of this FZR1 antibody (ARP51279_P050)

Click here to view the FZR1 antibody Western Blot Protocol

Product Datasheet Link: FZR1 antibody (ARP51279_P050)

WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B

Western Blot image:

Description of Target: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FZR1 antibody (ARP51279_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question