website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

FZR1 antibody - N-terminal region (ARP51279_P050)

Description of Target:
FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Gene Symbol:
FZR1
Official Gene Full Name:
Fizzy/cell division cycle 20 related 1 (Drosophila)
NCBI Gene Id:
51343
Alias Symbols:
CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1; KIAA1242
Sample Type Confirmation:

FZR1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FZR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FZR1.
Swissprot Id:
Q9UM11
Protein Accession #:
NP_057347
Nucleotide Accession #:
NM_016263
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Fizzy-related protein homolog
Protein Size (# AA):
493
Molecular Weight:
55kDa
Application:
WB
Protein Interactions:
ZC3HC1; CDC25A; CCNB1; UBE2S; UBE2C; PTTG1; UBE2D2; TP53; CDR2; UBE2K; ANAPC4; PDS1; STAU1; CDK2; CDC27; RACGAP1; FOXM1; HECW2; PHF8; BTRC; CCNA1; UBC; SOX2; SKP2; PLK1; CUL1; CUEDC2; CDC20; kif22; SIRT2; CLSPN; ANAPC11; CDC14B; VHL; PTEN; EYA1; DAXX; BUB
Immunogen:
The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
FZR1 antibody - N-terminal region (ARP51279_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Rat, Mouse, Dog, Pig, Horse, Guinea pig, Human, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-FZR1 antibody
- ARP51279_P050
Peptide Sequence:
Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Blocking Peptide:
For anti-FZR1 antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: FZR1 antibody tested with Human 721_B_Lymphoblast (ARP51279_P050)

Aviva Systems Biology is the original manufacturer of this FZR1 antibody (ARP51279_P050)

Click here to view the FZR1 antibody Western Blot Protocol

Product Datasheet Link: FZR1 antibody (ARP51279_P050)

WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B

Western Blot image:


Description of Target: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FZR1 antibody (ARP51279_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question