- Description of Target:
- The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins. It is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It also plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.
- Gene Symbol:
- E2F4
- Official Gene Full Name:
- E2F transcription factor 4, p107/p130-binding
- Alias Symbols:
- E2F-4
- Tissue Tool:
- Find tissues and cell lines supported to express E2F4.
- Protein Accession# :
- NP_001941
- Nucleotide Accession#:
- NM_001950
- Swissprot Id:
- Q16254
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 413
- Molecular Weight:
- 44kDa
- Application:
- WB, IHC
- Partner Proteins:
- CREB3, DR1, NFIL3, DR1
- Immunogen:
- The immunogen for anti-E2F4 antibody: synthetic peptide directed towards the C terminal of human E2F4
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- E2F4 antibody - C-terminal region (ARP31175_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Zebrafish: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-E2F4 antibody
- ARP31175_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL
- Blocking Peptide:
- For anti-E2F4 antibody is Catalog # AAP31175 (Previous Catalog # AAPP01918)
- Key Reference:
- DuPree,E.L., et al., (2004) Cancer Res. 64 (13), 4390-4393
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-E2F4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: E2F4 antibody tested with Human Hepg2 Cells (ARP31175_P050)
Aviva Systems Biology is the original manufacturer of this E2F4 antibody (ARP31175_P050)
Click here to view the E2F4 antibody Western Blot Protocol
Product Datasheet Link: E2F4 antibody (ARP31175_P050)
WB Suggested Anti-E2F4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2
Western Blot image: 
Description of Target: The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins. It is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It also plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s E2F4 antibody (ARP31175_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: E2F4 antibody tested by IHC with human intestine (ARP31175)
Aviva Systems Biology is the original manufacturer of this E2F4 antibody.
Click here to view the E2F4 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: E2F4 antibody (ARP31175)
IHC Information:
Rabbit Anti-E2F4 Antibody
Catalog Number: ARP31175
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
Product Protocols: E2F4 antibody tested by IHC with human stomach (ARP31175)
Aviva Systems Biology is the original manufacturer of this E2F4 antibody.
Click here to view the E2F4 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: E2F4 antibody (ARP31175)
IHC Information:
Rabbit Anti-E2F4 Antibody
Catalog Number: ARP31175
Paraffin Embedded Tissue: Human Stomach
Cellular Data: Nerve cells of myenteric plexus
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
