website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CDC25C antibody - N-terminal region (AVARP03034_P050)

Description of Target:
CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
Gene Symbol:
CDC25C
Official Gene Full Name:
Cell division cycle 25 homolog C (S. pombe)
NCBI Gene Id:
995
Alias Symbols:
CDC25; PPP1R60
Sample Type Confirmation:

There is BioGPS gene expression data showing that CDC25C is expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CDC25C.
Protein Accession #:
NP_073720
Nucleotide Accession#:
NM_022809
Swissprot Id:
P30307
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
M-phase inducer phosphatase 3
Protein Size (# AA):
400
Molecular Weight:
45kDa
Application:
WB
Partner Proteins:
CAND1, COMMD1, GPS1, NEDD8, RNF7, TCEB1, VHL, ZER1, ZYG11B, ASB4, CAB39, CAND1, CMBL, COMMD1, COPS5, COPS6, DCUN1D1, DLG3, HIF1A, KCTD5, NEDD8, P4HB, PFKFB3, RBX1, RNF7, RNMTL1, RPL35P5, Rbx1, SAP130, STOM, Socs1, TCEAL1, TCEB1, TCEB2, TFE3, TIMM13, VHL, Wsb1
Immunogen:
The immunogen for anti-CDC25C antibody: synthetic peptide directed towards the N terminal of human CDC25C
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CDC25C antibody - N-terminal region (AVARP03034_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 91%; Rabbit: 83%
Species Reactivity:
Human, Mouse, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-CDC25C antibody
- AVARP03034_P050
Peptide Sequence:
Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE
Blocking Peptide:
For anti-CDC25C antibody is Catalog # AAP30150 (Previous Catalog # AAPP00307)
Key Reference:
Bonnet,J., (2008) Biochem. Biophys. Res. Commun. 370 (3), 483-488
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CDC25C antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question