website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

CDC25C antibody - N-terminal region (AVARP03034_P050)

Description of Target:
CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
Gene Symbol:
Official Gene Full Name:
Cell division cycle 25 homolog C (S. pombe)
NCBI Gene Id:
Alias Symbols:
CDC25; PPP1R60
Sample Type Confirmation:

There is BioGPS gene expression data showing that CDC25C is expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDC25C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDC25C.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
M-phase inducer phosphatase 3
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the N terminal region of human CDC25C
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-CDC25C (AVARP03034_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 91%; Rabbit: 83%
Species Reactivity:
Human; Mouse; Rabbit
Datasheets / Downloads:
Printable datasheet for anti-CDC25C (AVARP03034_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE
Blocking Peptide:
For anti-CDC25C (AVARP03034_P050) antibody is Catalog # AAP30150 (Previous Catalog # AAPP00307)
Target Reference:
Bonnet,J., (2008) Biochem. Biophys. Res. Commun. 370 (3), 483-488
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: CDC25C antibody tested with Human Jurkat Cells (AVARP03034_P050)

Aviva Systems Biology is the original manufacturer of this CDC25C antibody (AVARP03034_P050)

Click here to view the CDC25C antibody Western Blot Protocol

Product Datasheet Link: CDC25C antibody (AVARP03034_P050)

WB Suggested Anti-CDC25C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:

Description of Target: CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CDC25C antibody (AVARP03034_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question