website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CDC25C antibody - N-terminal region (AVARP03034_P050)

Description of Target:
CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
Gene Symbol:
CDC25C
Official Gene Full Name:
Cell division cycle 25 homolog C (S. pombe)
NCBI Gene Id:
995
Alias Symbols:
CDC25; PPP1R60
Sample Type Confirmation:

There is BioGPS gene expression data showing that CDC25C is expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CDC25C.
Protein Accession #:
NP_073720
Nucleotide Accession#:
NM_022809
Swissprot Id:
P30307
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
M-phase inducer phosphatase 3
Protein Size (# AA):
400
Molecular Weight:
45kDa
Application:
WB
Partner Proteins:
CAND1, COMMD1, GPS1, NEDD8, RNF7, TCEB1, VHL, ZER1, ZYG11B, ASB4, CAB39, CAND1, CMBL, COMMD1, COPS5, COPS6, DCUN1D1, DLG3, HIF1A, KCTD5, NEDD8, P4HB, PFKFB3, RBX1, RNF7, RNMTL1, RPL35P5, Rbx1, SAP130, STOM, Socs1, TCEAL1, TCEB1, TCEB2, TFE3, TIMM13, VHL, Wsb1
Immunogen:
The immunogen for anti-CDC25C antibody: synthetic peptide directed towards the N terminal of human CDC25C
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CDC25C antibody - N-terminal region (AVARP03034_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 91%; Rabbit: 83%
Species Reactivity:
Human, Mouse, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-CDC25C antibody
- AVARP03034_P050
Peptide Sequence:
Synthetic peptide located within the following region: QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE
Blocking Peptide:
For anti-CDC25C antibody is Catalog # AAP30150 (Previous Catalog # AAPP00307)
Target Reference:
Bonnet,J., (2008) Biochem. Biophys. Res. Commun. 370 (3), 483-488
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CDC25C antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for CDC25C antibody (AVARP03034)

Product page for CDC25C antibody (AVARP03034)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Golden hamster MPIP3 antibody; Mesocricetus auratus MPIP3 antibody P48968 90%
Human CDC25C antibody; Homo sapiens CDC25C antibody G3V1P6 100%
Human MPIP3 antibody; Homo sapiens MPIP3 antibody P30307 100%
Human MPIP3 antibody; Homo sapiens MPIP3 antibody P30307-4 100%
Human MPIP3 antibody; Homo sapiens MPIP3 antibody P30307-3 100%
Human MPIP3 antibody; Homo sapiens MPIP3 antibody P30307-2 100%
Lowland gorilla CDC25C antibody; Gorilla gorilla gorilla CDC25C antibody G3QEW4 100%
Mouse Cdc25c antibody; Mus musculus Cdc25c antibody Q3UR74 91%
Mouse MPIP3 antibody; Mus musculus MPIP3 antibody P48967 91%
Northern white-cheeked gibbon CDC25C antibody; Nomascus leucogenys CDC25C antibody G1RCC2 100%
Northern white-cheeked gibbon CDC25C antibody; Nomascus leucogenys CDC25C antibody G1RCC1 100%
Northern white-cheeked gibbon CDC25C antibody; Nomascus leucogenys CDC25C antibody G1RCB9 100%
Northern white-cheeked gibbon CDC25C antibody; Nomascus leucogenys CDC25C antibody G1RCB6 100%
Rabbit CDC25C antibody; Oryctolagus cuniculus CDC25C antibody G1SV29 83%
Rhesus macaque CDC25C antibody; Macaca mulatta CDC25C antibody F7FH15 100%
Rhesus macaque CDC25C antibody; Macaca mulatta CDC25C antibody F7FH10 100%
Rhesus macaque CDC25C antibody; Macaca mulatta CDC25C antibody F7FH04 100%
Rhesus macaque CDC25C antibody; Macaca mulatta CDC25C antibody F7CTB3 100%

Product Protocols: CDC25C antibody tested with Human Jurkat Cells (AVARP03034_P050)

Aviva Systems Biology is the original manufacturer of this CDC25C antibody (AVARP03034_P050)

Click here to view the CDC25C antibody Western Blot Protocol

Product Datasheet Link: CDC25C antibody (AVARP03034_P050)

WB Suggested Anti-CDC25C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:


Description of Target: CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CDC25C antibody (AVARP03034_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question