- Description of Target:
- MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.
- Gene Symbol:
- MCM7
- Official Gene Full Name:
- Minichromosome maintenance complex component 7
- Tissue Tool:
- Find tissues and cell lines supported to express MCM7.
- Swissprot Id:
- P33993-2
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 389
- Molecular Weight:
- 42kDa
- Application:
- WB
- Partner Proteins:
- MCM4, MCM6, MCM7, CDC6, CDC6, MCM4, MCM6, MCM7, ORC2L, ORC2L
- Immunogen:
- The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- MCM7 antibody - middle region (ARP36667_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%; African clawed frog: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-MCM7 antibody
- ARP36667_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
- Blocking Peptide:
- For anti-MCM7 antibody is Catalog # AAP36667 (Previous Catalog # AAPP07924)
- Key Reference:
- Wang,Y., et al., (2000) FEBS Lett. 484 (1), 17-21
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-MCM7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: MCM7 antibody tested with Human Hepg2 Cells (ARP36667_T100)
Aviva Systems Biology is the original manufacturer of this MCM7 antibody (ARP36667_T100)
Click here to view the MCM7 antibody Western Blot Protocol
Product Datasheet Link: MCM7 antibody (ARP36667_T100)
WB Suggested Anti-MCM7 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2
Western Blot image: 
Description of Target: MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s MCM7 antibody (ARP36667_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
