FZR1 antibody - N-terminal region (ARP51279_P050)

Catalog#: ARP51279_P050

• Size: 50ug

Human 721_B

• Description of Target: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
• Gene Symbol: FZR1
• Official Gene Full Name: Fizzy/cell division cycle 20 related 1 (Drosophila)
• Alias Symbols: CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1; KIAA1242
• Protein Accession#: NP_057347
• Nucleotide Accession#: NM_016263
• Swissprot Id: Q9UM11
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 493
• Molecular Weight: 55kDa
• Application: WB
• Partner Proteins: CCNB1, CDC27, NEDD9, ANAPC2, C7orf25, CCNB1, CDC14A, CDC27, CDK2, DNAJA1, FBXO5, SKIL, SKP2, SKP2, ANAPC1, ANAPC2, ANAPC4, ANAPC5, ANAPC7, CDC14A, CDC20, CDC27, CDT1, FBXO5, MAD2L2, SKIL, TPX2
• Immunogen: The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
• Blocking Peptide: For anti-FZR1 antibody is Catalog # AAP51279 (Previous Catalog # AAPS22306)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-FZR1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: FZR1 antibody tested with Human 721_B_Lymphoblast (ARP51279_P050)

Aviva Systems Biology is the original manufacturer of this FZR1 antibody (ARP51279_P050)

Click here to view the FZR1 antibody Western Blot Protocol

Product Datasheet Link: FZR1 antibody (ARP51279_P050)

WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B

Western Blot image:


Description of Target: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FZR1 antibody (ARP51279_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com