CDC23 antibody - C-terminal region (ARP43040_P050)

Catalog#: ARP43040_P050

• Size: 50ug

Human Jurkat

• Description of Target: CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.
• Gene Symbol: CDC23
• Official Gene Full Name: Cell division cycle 23 homolog (S. cerevisiae)
• Alias Symbols: APC8; CUT23; ANAPC8
• Protein Accession#: NP_004652
• Nucleotide Accession#: NM_004661
• Swissprot Id: Q9UJX2
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 591
• Molecular Weight: 65kDa
• Application: WB
• Partner Proteins: GZMB, VCP, PTP4A3
• Immunogen: The immunogen for anti-CDC23 antibody: synthetic peptide directed towards the C terminal of human CDC23
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%
• Peptide Sequence: Synthetic peptide located within the following region: DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL
• Blocking Peptide: For anti-CDC23 antibody is Catalog # AAP43040 (Previous Catalog # AAPP11247)
• Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CDC23 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CDC23 antibody tested with Human Jurkat Cells (ARP43040_P050)

Aviva Systems Biology is the original manufacturer of this CDC23 antibody (ARP43040_P050)

Click here to view the CDC23 antibody Western Blot Protocol

Product Datasheet Link: CDC23 antibody (ARP43040_P050)

WB Suggested Anti-CDC23 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CDC23 antibody (ARP43040_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com