- Description of Target:
- CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
- Gene Symbol:
- CCNB3
- Official Gene Full Name:
- Cyclin B3
- Alias Symbols:
- -
- Tissue Tool:
- Find tissues and cell lines supported to express CCNB3.
- Protein Accession# :
- NP_149020
- Nucleotide Accession#:
- NM_033031
- Swissprot Id:
- Q8WWL7
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 1395
- Molecular Weight:
- 158kDa
- Application:
- WB
- Partner Proteins:
- BTBD1, BTBD2, TRIM5, TRIM6, TRIM5, UBC, UBE2D2
- Immunogen:
- The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CCNB3 antibody - C-terminal region (ARP39740_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-CCNB3 antibody
- ARP39740_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE
- Blocking Peptide:
- For anti-CCNB3 antibody is Catalog # AAP39740 (Previous Catalog # AAPY02112)
- Key Reference:
- Cheng,J., (2005) Science 308 (5725), 1149-1154
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CCNB3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CCNB3 antibody tested with Human Fetal Muscle Tissue (ARP39740_P050)
Aviva Systems Biology is the original manufacturer of this CCNB3 antibody (ARP39740_P050)
Click here to view the CCNB3 antibody Western Blot Protocol
Product Datasheet Link: CCNB3 antibody (ARP39740_P050)
WB Suggested Anti-CCNB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Muscle
Western Blot image: 
Description of Target: CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CCNB3 antibody (ARP39740_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
