- Description of Target:
- The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].
- Gene Symbol:
- ANAPC7
- Official Gene Full Name:
- Anaphase promoting complex subunit 7
- Alias Symbols:
- APC7
- Tissue Tool:
- Find tissues and cell lines supported to express ANAPC7.
- Protein Accession# :
- NP_057322
- Nucleotide Accession#:
- NM_016238
- Swissprot Id:
- Q9UJX3
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 565
- Molecular Weight:
- 62kDa
- Application:
- WB, IHC
- Subunit:
- 7
- Immunogen:
- The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- ANAPC7 antibody - C-terminal region (ARP41605_P050)
- Predicted Homology Based on Immunogen Sequence:
- African clawed frog: 100%; Chicken: 100%; Human: 100%; Rat: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-ANAPC7 antibody
- ARP41605_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
- Blocking Peptide:
- For anti-ANAPC7 antibody is Catalog # AAP41605 (Previous Catalog # AAPP24288)
- Key Reference:
- Turnell,A.S., (2005) Nature 438 (7068), 690-695
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-ANAPC7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: ANAPC7 antibody tested with Human Jurkat Cells (ARP41605_P050)
Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody (ARP41605_P050)
Click here to view the ANAPC7 antibody Western Blot Protocol
Product Datasheet Link: ANAPC7 antibody (ARP41605_P050)
WB Suggested Anti-ANAPC7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat
Western Blot image: 
Description of Target: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s ANAPC7 antibody (ARP41605_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: ANAPC7 antibody tested by IHC with human intestine (ARP41605)
Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody.
Click here to view the ANAPC7 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: ANAPC7 antibody (ARP41605)
IHC Information:
Rabbit Anti-ANAPC7 Antibody
Catalog Number: ARP41605
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
