website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ANAPC7 antibody - C-terminal region (ARP41605_P050)

Description of Target:
The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].
Gene Symbol:
Official Gene Full Name:
Anaphase promoting complex subunit 7
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express ANAPC7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Anaphase-promoting complex subunit 7
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
ANAPC7 antibody - C-terminal region (ARP41605_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-ANAPC7 antibody
- ARP41605_P050
Peptide Sequence:
Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Blocking Peptide:
For anti-ANAPC7 antibody is Catalog # AAP41605 (Previous Catalog # AAPP24288)
Target Reference:
Turnell,A.S., (2005) Nature 438 (7068), 690-695
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ANAPC7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for ANAPC7 antibody (ARP41605)

Product page for ANAPC7 antibody (ARP41605)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog anapc7 antibody; Xenopus laevis anapc7 antibody Q6DDX5 100%
African clawed frog MGC81861 antibody; Xenopus laevis MGC81861 antibody Q641E4 100%
Chicken ANAPC7 antibody; Gallus gallus ANAPC7 antibody E1C8I2 100%
Chinese hamster Anapc7 antibody; Cricetulus griseus Anapc7 antibody G3H237 100%
Dog Cfa.41448 antibody; Canis familiaris Cfa.41448 antibody E2R9A5 100%
Duckbill platypus 100073818 antibody; Ornithorhynchus anatinus 100073818 antibody F7FN76 100%
Gray short-tailed opossum LOC100020392 antibody; Monodelphis domestica LOC100020392 antibody F6TIQ7 100%
Guinea pig LOC100716878 antibody; Cavia porcellus LOC100716878 antibody H0VU06 100%
Horse LOC100058376 antibody; Equus caballus LOC100058376 antibody F6UNJ4 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody Q69YV3 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody Q4KMX6 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody Q2M2R1 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody H0YIW2 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody F8VVU6 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody A8KAQ7 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody A5D8X2 100%
Human ANAPC7 antibody; Homo sapiens ANAPC7 antibody F8VVT8 100%
Human APC7 antibody; Homo sapiens APC7 antibody Q9UJX3 100%
Mouse APC7 antibody; Mus musculus APC7 antibody Q9WVM3 100%
Rat Anapc7 antibody; Rattus norvegicus Anapc7 antibody D3ZIT4 85%
Rhesus macaque ANAPC7 antibody; Macaca mulatta ANAPC7 antibody G7N5G4 100%
Rhesus macaque ANAPC7 antibody; Macaca mulatta ANAPC7 antibody F6ZY88 100%
Western clawed frog anapc7 antibody; Xenopus tropicalis anapc7 antibody Q28GD7 100%
Western clawed frog anapc7 antibody; Xenopus tropicalis anapc7 antibody F6ZZM9 100%
White-tufted-ear marmoset LOC100399467 antibody; Callithrix jacchus LOC100399467 antibody F7HW59 100%
Zebra finch LOC100230492 antibody; Taeniopygia guttata LOC100230492 antibody H0Z5N5 100%

Product Protocols: ANAPC7 antibody tested with Human Jurkat Cells (ARP41605_P050)

Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody (ARP41605_P050)

Click here to view the ANAPC7 antibody Western Blot Protocol

Product Datasheet Link: ANAPC7 antibody (ARP41605_P050)

WB Suggested Anti-ANAPC7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ANAPC7 antibody (ARP41605_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: ANAPC7 antibody tested by IHC with human intestine (ARP41605)

Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody.

Click here to view the ANAPC7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ANAPC7 antibody (ARP41605)

IHC Information:

Rabbit Anti-ANAPC7 Antibody
Catalog Number: ARP41605
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question