website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ANAPC7 antibody - C-terminal region (ARP41605_P050)

Description of Target:
The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].
Gene Symbol:
Official Gene Full Name:
Anaphase promoting complex subunit 7
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANAPC7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANAPC7.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Anaphase-promoting complex subunit 7
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the C terminal region of human ANAPC7
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-ANAPC7 (ARP41605_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-ANAPC7 (ARP41605_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Blocking Peptide:
For anti-ANAPC7 (ARP41605_P050) antibody is Catalog # AAP41605 (Previous Catalog # AAPP24288)
Target Reference:
Turnell,A.S., (2005) Nature 438 (7068), 690-695
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ANAPC7 antibody tested with Human Jurkat Cells (ARP41605_P050)

Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody (ARP41605_P050)

Click here to view the ANAPC7 antibody Western Blot Protocol

Product Datasheet Link: ANAPC7 antibody (ARP41605_P050)

WB Suggested Anti-ANAPC7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ANAPC7 antibody (ARP41605_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: ANAPC7 antibody tested by IHC with human intestine (ARP41605)

Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody.

Click here to view the ANAPC7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ANAPC7 antibody (ARP41605)

IHC Information:

Rabbit Anti-ANAPC7 Antibody
Catalog Number: ARP41605
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question