website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ANAPC7 antibody - C-terminal region (ARP41605_P050)

Description of Target:
The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].
Gene Symbol:
Official Gene Full Name:
Anaphase promoting complex subunit 7
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express ANAPC7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Anaphase-promoting complex subunit 7
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
ANAPC7 antibody - C-terminal region (ARP41605_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-ANAPC7 antibody
- ARP41605_P050
Peptide Sequence:
Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Blocking Peptide:
For anti-ANAPC7 antibody is Catalog # AAP41605 (Previous Catalog # AAPP24288)
Key Reference:
Turnell,A.S., (2005) Nature 438 (7068), 690-695
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ANAPC7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question