website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ANAPC10 antibody - N-terminal region (ARP43169_P050)

Description of Target:
ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub
Gene Symbol:
Official Gene Full Name:
Anaphase promoting complex subunit 10
NCBI Gene Id:
Alias Symbols:
APC10; DKFZP564L0562; DOC1
Tissue Tool:
Find tissues and cell lines supported to express ANAPC10.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Anaphase-promoting complex subunit 10
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
ANAPC4; DCPS; UBC; ANAPC15; MDC1; TP53BP1; LIG4; ANAPC1; ANAPC7; ANAPC2; CDC16; CDC23; CDC27; Gm9174; Cdc20; Bub1b; PPP2R1A; APC2; ANAPC11; SMAD3; SMAD2; LRP1; LRP8; LRP2;
The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
ANAPC10 antibody - N-terminal region (ARP43169_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Species Reactivity:
Rat, Pig, Human, Dog, Bovine, Horse, Rabbit, Guinea pig, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-ANAPC10 antibody
- ARP43169_P050
Peptide Sequence:
Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
Blocking Peptide:
For anti-ANAPC10 antibody is Catalog # AAP43169 (Previous Catalog # AAPP25138)
Target Reference:
Nourry,C., (er) BMC Cell Biol. 5, 20 (2004)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for ANAPC10 antibody (ARP43169)

Product page for ANAPC10 antibody (ARP43169)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog anapc10 antibody; Xenopus laevis anapc10 antibody Q5EAZ2 92%
African clawed frog LOC595046 antibody; Xenopus laevis LOC595046 antibody Q5HZC0 92%
African elephant LOC100668375 antibody; Loxodonta africana LOC100668375 antibody G3T394 100%
Bovine ANAPC10 antibody; Bos taurus ANAPC10 antibody F2Z4G9 100%
Bovine APC10 antibody; Bos taurus APC10 antibody Q2YDH1 100%
Chicken ANAPC10 antibody; Gallus gallus ANAPC10 antibody Q5ZL04 100%
Chinese hamster LOC100772439 antibody; Cricetulus griseus LOC100772439 antibody G3H9G3 100%
Common turkey LOC100544284 antibody; Meleagris gallopavo LOC100544284 antibody G1MX14 100%
Dog ANAPC10 antibody; Canis familiaris ANAPC10 antibody E2R745 100%
Duckbill platypus LOC100081513 antibody; Ornithorhynchus anatinus LOC100081513 antibody F7DUE6 100%
Giant panda LOC100477128 antibody; Ailuropoda melanoleuca LOC100477128 antibody D2H3Q0 100%
Gray short-tailed opossum LOC100019010 antibody; Monodelphis domestica LOC100019010 antibody F6UT46 100%
Green anole LOC100552925 antibody; Anolis carolinensis LOC100552925 antibody G1KBT5 92%
Guinea pig LOC100728363 antibody; Cavia porcellus LOC100728363 antibody H0V9Y1 100%
Horse LOC100062837 antibody; Equus caballus LOC100062837 antibody F6X9H3 100%
Human ANAPC10 antibody; Homo sapiens ANAPC10 antibody D6RD74 100%
Human ANAPC10 antibody; Homo sapiens ANAPC10 antibody D6RB36 100%
Human ANAPC10 antibody; Homo sapiens ANAPC10 antibody D6RA92 100%
Human ANAPC10 antibody; Homo sapiens ANAPC10 antibody D6R9Q5 100%
Human APC10 antibody; Homo sapiens APC10 antibody Q9UM13 100%
Little brown bat ANAPC10 antibody; Myotis lucifugus ANAPC10 antibody G1PBT8 100%
Lowland gorilla ANAPC10 antibody; Gorilla gorilla gorilla ANAPC10 antibody G3S5D3 100%
Mouse APC10 antibody; Mus musculus APC10 antibody Q8K2H6 100%
Northern white-cheeked gibbon LOC100604389 antibody; Nomascus leucogenys LOC100604389 antibody G1R082 100%
Pig APC10 antibody; Sus scrofa APC10 antibody D5L7X1 100%
Pig APC10 antibody; Sus scrofa APC10 antibody D5L7X2 100%
Rabbit ANAPC10 antibody; Oryctolagus cuniculus ANAPC10 antibody G1SG69 100%
Rat Anapc10 antibody; Rattus norvegicus Anapc10 antibody B5DEP3 100%
Rhesus macaque ANAPC10 antibody; Macaca mulatta ANAPC10 antibody F7GPG7 100%
Small-eared galago ANAPC10 antibody; Otolemur garnettii ANAPC10 antibody H0WV60 100%
Spotted green pufferfish ANAPC10 antibody; Tetraodon nigroviridis ANAPC10 antibody Q4T330 92%
Tasmanian devil ANAPC10 antibody; Sarcophilus harrisii ANAPC10 antibody G3W7S4 100%
Tasmanian devil ANAPC10 antibody; Sarcophilus harrisii ANAPC10 antibody G3W7S3 100%
Three-spined stickleback ANAPC10 antibody; Gasterosteus aculeatus ANAPC10 antibody G3Q3Z5 92%
Three-spined stickleback ANAPC10 antibody; Gasterosteus aculeatus ANAPC10 antibody G3Q3Z2 92%
Western clawed frog anapc10 antibody; Xenopus tropicalis anapc10 antibody Q28GX7 92%
White-tufted-ear marmoset LOC100404610 antibody; Callithrix jacchus LOC100404610 antibody F6YKG3 100%
Zebra finch LOC100229221 antibody; Taeniopygia guttata LOC100229221 antibody H0YWW5 100%
Zebrafish LOC798352 antibody; Danio rerio LOC798352 antibody E7FCJ1 84%

Product Protocols: ANAPC10 antibody tested with Human Fetal Spleen Tissue (ARP43169_P050)

Aviva Systems Biology is the original manufacturer of this ANAPC10 antibody (ARP43169_P050)

Click here to view the ANAPC10 antibody Western Blot Protocol

Product Datasheet Link: ANAPC10 antibody (ARP43169_P050)

WB Suggested Anti-ANAPC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:

Description of Target: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ANAPC10 antibody (ARP43169_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question