website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

ANAPC10 antibody - N-terminal region (ARP43169_P050)

Description of Target:
ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub
Gene Symbol:
ANAPC10
Official Gene Full Name:
Anaphase promoting complex subunit 10
NCBI Gene Id:
10393
Alias Symbols:
APC10; DKFZP564L0562; DOC1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANAPC10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANAPC10.
Swissprot Id:
Q9UM13
Protein Accession #:
NP_055700
Nucleotide Accession #:
NM_014885
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Anaphase-promoting complex subunit 10
Protein Size (# AA):
185
Molecular Weight:
21kDa
Application:
WB
Subunit:
10
Protein Interactions:
ANAPC4; DCPS; UBC; ANAPC15; MDC1; TP53BP1; LIG4; ANAPC1; ANAPC7; ANAPC2; CDC16; CDC23; CDC27; Gm9174; Cdc20; Bub1b; PPP2R1A; APC2; ANAPC11; SMAD3; SMAD2; LRP1; LRP8; LRP2;
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ANAPC10
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-ANAPC10 (ARP43169_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Species Reactivity:
Rat, Pig, Human, Dog, Bovine, Horse, Rabbit, Guinea pig, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-ANAPC10 (ARP43169_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
Blocking Peptide:
For anti-ANAPC10 (ARP43169_P050) antibody is Catalog # AAP43169 (Previous Catalog # AAPP25138)
Target Reference:
Nourry,C., (er) BMC Cell Biol. 5, 20 (2004)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ANAPC10 antibody tested with Human Fetal Spleen Tissue (ARP43169_P050)

Aviva Systems Biology is the original manufacturer of this ANAPC10 antibody (ARP43169_P050)

Click here to view the ANAPC10 antibody Western Blot Protocol

Product Datasheet Link: ANAPC10 antibody (ARP43169_P050)

WB Suggested Anti-ANAPC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:


Description of Target: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ANAPC10 antibody (ARP43169_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question