- Description of Target:
- ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub
- Gene Symbol:
- ANAPC10
- Official Gene Full Name:
- Anaphase promoting complex subunit 10
- Alias Symbols:
- APC10; DKFZP564L0562; DOC1
- Tissue Tool:
- Find tissues and cell lines supported to express ANAPC10.
- Protein Accession# :
- NP_055700
- Nucleotide Accession#:
- NM_014885
- Swissprot Id:
- Q9UM13
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 185
- Molecular Weight:
- 21kDa
- Application:
- WB
- Subunit:
- 10
- Immunogen:
- The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- ANAPC10 antibody - N-terminal region (ARP43169_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-ANAPC10 antibody
- ARP43169_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
- Blocking Peptide:
- For anti-ANAPC10 antibody is Catalog # AAP43169 (Previous Catalog # AAPP25138)
- Key Reference:
- Nourry,C., (er) BMC Cell Biol. 5, 20 (2004)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-ANAPC10 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: ANAPC10 antibody tested with Human Fetal Spleen Tissue (ARP43169_P050)
Aviva Systems Biology is the original manufacturer of this ANAPC10 antibody (ARP43169_P050)
Click here to view the ANAPC10 antibody Western Blot Protocol
Product Datasheet Link: ANAPC10 antibody (ARP43169_P050)
WB Suggested Anti-ANAPC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen
Western Blot image: 
Description of Target: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s ANAPC10 antibody (ARP43169_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
