website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

ANAPC10 antibody - N-terminal region (ARP43169_P050)

Description of Target:
ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and sub
Gene Symbol:
ANAPC10
Official Gene Full Name:
Anaphase promoting complex subunit 10
NCBI Gene Id:
10393
Alias Symbols:
APC10; DKFZP564L0562; DOC1
Tissue Tool:
Find tissues and cell lines supported to express ANAPC10.
Protein Accession #:
NP_055700
Nucleotide Accession#:
NM_014885
Swissprot Id:
Q9UM13
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Anaphase-promoting complex subunit 10
Protein Size (# AA):
185
Molecular Weight:
21kDa
Application:
WB
Subunit:
10
Immunogen:
The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
ANAPC10 antibody - N-terminal region (ARP43169_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Species Reactivity:
Rat, Pig, Human, Dog, Bovine, Horse, Rabbit, Guinea pig, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-ANAPC10 antibody
- ARP43169_P050
Peptide Sequence:
Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL
Blocking Peptide:
For anti-ANAPC10 antibody is Catalog # AAP43169 (Previous Catalog # AAPP25138)
Key Reference:
Nourry,C., (er) BMC Cell Biol. 5, 20 (2004)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ANAPC10 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question